| Line |
Branch |
Exec |
Source |
| 1 |
|
|
/* BEGIN software license |
| 2 |
|
|
* |
| 3 |
|
|
* MsXpertSuite - mass spectrometry software suite |
| 4 |
|
|
* ----------------------------------------------- |
| 5 |
|
|
* Copyright(C) 2009, ..., 2018 Filippo Rusconi |
| 6 |
|
|
* |
| 7 |
|
|
* http://www.msxpertsuite.org |
| 8 |
|
|
* |
| 9 |
|
|
* This file is part of the MsXpertSuite project. |
| 10 |
|
|
* |
| 11 |
|
|
* The MsXpertSuite project is the successor of the massXpert project. This |
| 12 |
|
|
* project now includes various independent modules: |
| 13 |
|
|
* |
| 14 |
|
|
* - massXpert, model polymer chemistries and simulate mass spectrometric data; |
| 15 |
|
|
* - mineXpert, a powerful TIC chromatogram/mass spectrum viewer/miner; |
| 16 |
|
|
* |
| 17 |
|
|
* This program is free software: you can redistribute it and/or modify |
| 18 |
|
|
* it under the terms of the GNU General Public License as published by |
| 19 |
|
|
* the Free Software Foundation, either version 3 of the License, or |
| 20 |
|
|
* (at your option) any later version. |
| 21 |
|
|
* |
| 22 |
|
|
* This program is distributed in the hope that it will be useful, |
| 23 |
|
|
* but WITHOUT ANY WARRANTY; without even the implied warranty of |
| 24 |
|
|
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the |
| 25 |
|
|
* GNU General Public License for more details. |
| 26 |
|
|
* |
| 27 |
|
|
* You should have received a copy of the GNU General Public License |
| 28 |
|
|
* along with this program. If not, see <http://www.gnu.org/licenses/>. |
| 29 |
|
|
* |
| 30 |
|
|
* END software license |
| 31 |
|
|
*/ |
| 32 |
|
|
|
| 33 |
|
|
|
| 34 |
|
|
/////////////////////// Stdlib includes |
| 35 |
|
|
#include <vector> |
| 36 |
|
|
|
| 37 |
|
|
|
| 38 |
|
|
/////////////////////// Qt includes |
| 39 |
|
|
#include <QChar> |
| 40 |
|
|
#include <QString> |
| 41 |
|
|
#include <QUuid> |
| 42 |
|
|
|
| 43 |
|
|
|
| 44 |
|
|
/////////////////////// Local includes |
| 45 |
|
|
#include "MsXpS/libXpertMassCore/globals.hpp" |
| 46 |
|
|
#include "MsXpS/libXpertMassCore/Monomer.hpp" |
| 47 |
|
|
#include "MsXpS/libXpertMassCore/Formula.hpp" |
| 48 |
|
|
#include "MsXpS/libXpertMassCore/Utils.hpp" |
| 49 |
|
|
|
| 50 |
|
|
|
| 51 |
|
|
int monomerMetaTypeId = qRegisterMetaType<MsXpS::libXpertMassCore::Monomer>( |
| 52 |
|
|
"MsXpS::libXpertMassCore::Monomer"); |
| 53 |
|
|
|
| 54 |
|
|
|
| 55 |
|
|
namespace MsXpS |
| 56 |
|
|
{ |
| 57 |
|
|
namespace libXpertMassCore |
| 58 |
|
|
{ |
| 59 |
|
|
|
| 60 |
|
|
|
| 61 |
|
|
/*! |
| 62 |
|
|
\class MsXpS::libXpertMassCore::Monomer |
| 63 |
|
|
\inmodule libXpertMassCore |
| 64 |
|
|
\ingroup PolChemDefBuildingdBlocks |
| 65 |
|
|
\inheaderfile Monomer.hpp |
| 66 |
|
|
|
| 67 |
|
|
\brief The Monomer class provides abstractions to work with monomers. |
| 68 |
|
|
|
| 69 |
|
|
In libmass, a momomer is an entity that is part of a polymer chemistry |
| 70 |
|
|
definition. A monomer models a chemical entity that is part of a polymer. |
| 71 |
|
|
|
| 72 |
|
|
In protein chemistry, that would be a \e{residue}, that is, an amino-acid that |
| 73 |
|
|
has been polymerized into a residue chain (that is, a protein, or a peptide). |
| 74 |
|
|
The chemical reaction that polymerizez an amino acid into an elongating protein |
| 75 |
|
|
structure is a condensation, with loss of H2O from the amino acid to actually |
| 76 |
|
|
lead to a what is called a \e{residue} of a monomer, or for short a \e{residue}. |
| 77 |
|
|
|
| 78 |
|
|
\note The monomer, that is partly defined by its formula, has the formula of the |
| 79 |
|
|
\e{residue}, not of the amino acid. This is always true, whatever the polymer |
| 80 |
|
|
chemistry definition at hand: protein, saccharide, nucleic acid. |
| 81 |
|
|
*/ |
| 82 |
|
|
|
| 83 |
|
|
|
| 84 |
|
|
/*! |
| 85 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::mcsp_polChemDef |
| 86 |
|
|
|
| 87 |
|
|
\brief The polymer chemistry definition that is the context in which the Monomer |
| 88 |
|
|
instance exists. |
| 89 |
|
|
*/ |
| 90 |
|
|
|
| 91 |
|
|
/*! |
| 92 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::m_name |
| 93 |
|
|
|
| 94 |
|
|
\brief The name of the monomer, like Lysine, Adenine. |
| 95 |
|
|
*/ |
| 96 |
|
|
|
| 97 |
|
|
/*! |
| 98 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::m_code |
| 99 |
|
|
|
| 100 |
|
|
\brief The code of the monomer, like K for lysine, A for adenine. |
| 101 |
|
|
*/ |
| 102 |
|
|
|
| 103 |
|
|
/*! |
| 104 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::m_formula |
| 105 |
|
|
|
| 106 |
|
|
\brief The formula of the monomer. |
| 107 |
|
|
*/ |
| 108 |
|
|
|
| 109 |
|
|
/*! |
| 110 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::m_modifs |
| 111 |
|
|
|
| 112 |
|
|
\brief The container of \l Modif instances that are involved in the modification |
| 113 |
|
|
of this Monomer. |
| 114 |
|
|
|
| 115 |
|
|
\note |
| 116 |
|
|
|
| 117 |
|
|
The Modif pointers stored in the m_modifs member are ModifSPtr pointers. |
| 118 |
|
|
*/ |
| 119 |
|
|
|
| 120 |
|
|
/*! |
| 121 |
|
|
\variable MsXpS::libXpertMassCore::Monomer::m_isValid |
| 122 |
|
|
|
| 123 |
|
|
\brief The validity status of the Monomer. |
| 124 |
|
|
*/ |
| 125 |
|
|
|
| 126 |
|
|
/*! |
| 127 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerRPtr |
| 128 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 129 |
|
|
|
| 130 |
|
|
Synonym for Monomer *. |
| 131 |
|
|
*/ |
| 132 |
|
|
|
| 133 |
|
|
/*! |
| 134 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerCstRPtr |
| 135 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 136 |
|
|
|
| 137 |
|
|
Synonym for const Monomer *. |
| 138 |
|
|
*/ |
| 139 |
|
|
|
| 140 |
|
|
/*! |
| 141 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerUPtr |
| 142 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 143 |
|
|
|
| 144 |
|
|
Synonym for std::unique_ptr<Monomer>. |
| 145 |
|
|
*/ |
| 146 |
|
|
|
| 147 |
|
|
/*! |
| 148 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerCstUPtr |
| 149 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 150 |
|
|
|
| 151 |
|
|
Synonym for std::unique_ptr<const Monomer>. |
| 152 |
|
|
*/ |
| 153 |
|
|
|
| 154 |
|
|
/*! |
| 155 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerSPtr |
| 156 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 157 |
|
|
|
| 158 |
|
|
Synonym for std::shared_ptr<Monomer>. |
| 159 |
|
|
*/ |
| 160 |
|
|
|
| 161 |
|
|
/*! |
| 162 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerCstSPtr |
| 163 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 164 |
|
|
|
| 165 |
|
|
Synonym for std::shared_ptr<const Monomer>. |
| 166 |
|
|
*/ |
| 167 |
|
|
|
| 168 |
|
|
/*! |
| 169 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerWPtr |
| 170 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 171 |
|
|
|
| 172 |
|
|
Synonym for std::weak_ptr<Monomer>. |
| 173 |
|
|
*/ |
| 174 |
|
|
|
| 175 |
|
|
/*! |
| 176 |
|
|
\typedef MsXpS::libXpertMassCore::MonomerCstWPtr |
| 177 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 178 |
|
|
|
| 179 |
|
|
Synonym for std::weak_ptr<const Monomer>. |
| 180 |
|
|
*/ |
| 181 |
|
|
|
| 182 |
|
|
/*! |
| 183 |
|
|
\typealias MsXpS::libXpertMassCore::UuidMonomerCstWPtrPair |
| 184 |
|
|
\relates MsXpS::libXpertMassCore::Monomer |
| 185 |
|
|
|
| 186 |
|
|
Synonym for std::pair<QString, MonomerCstWPtr> items. |
| 187 |
|
|
|
| 188 |
|
|
These pairs are used to store a unique identifier (Uuid) string related to |
| 189 |
|
|
a std::shared_ptr<const Monomer> type. This kind of pair is used in a |
| 190 |
|
|
container in the \l CrossLink class. The fact that the std::shared_ptr is |
| 191 |
|
|
converted to a std::weak_ptr is interesting because the item in the pair will |
| 192 |
|
|
not increase the reference count. |
| 193 |
|
|
*/ |
| 194 |
|
|
|
| 195 |
|
|
|
| 196 |
|
|
/*! |
| 197 |
|
|
\brief Constructs a monomer starting from an XML <mnm> \a element according to |
| 198 |
|
|
\a version and using the reference polymer chemistry definition \a |
| 199 |
|
|
pol_chem_def_csp. |
| 200 |
|
|
|
| 201 |
|
|
This is the current format: |
| 202 |
|
|
\code |
| 203 |
|
|
<mnm> |
| 204 |
|
|
<name>Glycine</name> |
| 205 |
|
|
<code>G</code> |
| 206 |
|
|
<formula>C2H3N1O1</formula> |
| 207 |
|
|
</mnm> |
| 208 |
|
|
\endcode |
| 209 |
|
|
*/ |
| 210 |
|
1439 |
Monomer::Monomer(PolChemDefCstSPtr pol_chem_def_csp, |
| 211 |
|
|
const QDomElement &element, |
| 212 |
|
1439 |
int version) |
| 213 |
5/8
✓ Branch 3 taken 1439 times.
✗ Branch 4 not taken.
✓ Branch 6 taken 1439 times.
✗ Branch 7 not taken.
✓ Branch 9 taken 1439 times.
✗ Branch 10 not taken.
✓ Branch 11 taken 3 times.
✓ Branch 12 taken 1436 times.
|
1439 |
: mcsp_polChemDef(pol_chem_def_csp) |
| 214 |
|
|
{ |
| 215 |
2/2
✓ Branch 0 taken 3 times.
✓ Branch 1 taken 1436 times.
|
1439 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 216 |
2/4
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 3 times.
✗ Branch 5 not taken.
|
3 |
qCritical() << "Constructing Monomer with no PolChemDef."; |
| 217 |
|
|
|
| 218 |
3/4
✓ Branch 1 taken 1439 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 10 times.
✓ Branch 4 taken 1429 times.
|
1439 |
if(!renderXmlMnmElement(element, version)) |
| 219 |
1/2
✓ Branch 1 taken 10 times.
✗ Branch 2 not taken.
|
20 |
qCritical() << "Failed to fully render or validate the Monomer XML element " |
| 220 |
1/2
✓ Branch 1 taken 10 times.
✗ Branch 2 not taken.
|
10 |
"for construction of Monomer instance."; |
| 221 |
|
|
|
| 222 |
|
|
// We cannot ask for validation because the polymer chemistry definition |
| 223 |
|
|
// might be unavailable when using the XML element rendering. |
| 224 |
|
|
|
| 225 |
|
|
// qDebug() << "Constructed Monomer" << m_name << ":" << toString(); |
| 226 |
0/2
✗ Branch 5 not taken.
✗ Branch 6 not taken.
|
1439 |
} |
| 227 |
|
|
|
| 228 |
|
|
|
| 229 |
|
|
/*! |
| 230 |
|
|
\brief Constructs a monomer with its member data set to \a name, \a code, \a |
| 231 |
|
|
formula_string, |
| 232 |
|
|
The \a pol_chem_def_csp and both masses \a mono and \a avg. |
| 233 |
|
|
|
| 234 |
|
|
The member m_isValid validity status is set to the result of this Monomer |
| 235 |
|
|
validation. |
| 236 |
|
|
*/ |
| 237 |
|
25718 |
Monomer::Monomer(PolChemDefCstSPtr pol_chem_def_csp, |
| 238 |
|
|
const QString &name, |
| 239 |
|
|
const QString &code, |
| 240 |
|
|
const QString &formula_string, |
| 241 |
|
|
double mono, |
| 242 |
|
25718 |
double avg) |
| 243 |
|
51436 |
: mcsp_polChemDef(pol_chem_def_csp), |
| 244 |
2/2
✓ Branch 0 taken 72 times.
✓ Branch 1 taken 25646 times.
|
25718 |
m_name(name), |
| 245 |
2/2
✓ Branch 0 taken 25660 times.
✓ Branch 1 taken 58 times.
|
25718 |
m_code(code), |
| 246 |
2/2
✓ Branch 0 taken 61 times.
✓ Branch 1 taken 25657 times.
|
25718 |
m_formula(formula_string), |
| 247 |
|
25718 |
m_mono(mono), |
| 248 |
2/2
✓ Branch 2 taken 25712 times.
✓ Branch 3 taken 6 times.
|
51436 |
m_avg(avg) |
| 249 |
|
|
{ |
| 250 |
3/4
✓ Branch 0 taken 25712 times.
✓ Branch 1 taken 6 times.
✓ Branch 3 taken 25712 times.
✗ Branch 4 not taken.
|
25718 |
if(mcsp_polChemDef != nullptr && mcsp_polChemDef.get() != nullptr) |
| 251 |
|
|
{ |
| 252 |
|
25712 |
ErrorList error_list; |
| 253 |
1/2
✓ Branch 1 taken 25712 times.
✗ Branch 2 not taken.
|
25712 |
m_isValid = validate(&error_list); |
| 254 |
|
|
|
| 255 |
2/2
✓ Branch 0 taken 25652 times.
✓ Branch 1 taken 60 times.
|
25712 |
if(!m_isValid) |
| 256 |
|
|
{ |
| 257 |
2/4
✓ Branch 1 taken 25652 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25652 times.
✗ Branch 5 not taken.
|
51304 |
qCritical() << "Construction of Monomer with validation errors:\n" |
| 258 |
3/6
✓ Branch 1 taken 25652 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25652 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 25652 times.
✗ Branch 8 not taken.
|
51304 |
<< Utils::joinErrorList(error_list, ", "); |
| 259 |
|
|
} |
| 260 |
|
25712 |
} |
| 261 |
|
|
else |
| 262 |
|
|
m_isValid = false; |
| 263 |
0/2
✗ Branch 5 not taken.
✗ Branch 6 not taken.
|
25718 |
} |
| 264 |
|
|
|
| 265 |
|
|
/*! |
| 266 |
|
|
\brief Constructs a monomer as a copy of \a other. |
| 267 |
|
|
*/ |
| 268 |
|
25650 |
Monomer::Monomer(const Monomer &other) |
| 269 |
|
|
: PropListHolder(other), |
| 270 |
|
51300 |
mcsp_polChemDef(other.mcsp_polChemDef), |
| 271 |
1/2
✓ Branch 0 taken 25650 times.
✗ Branch 1 not taken.
|
25650 |
m_name(other.m_name), |
| 272 |
1/2
✓ Branch 0 taken 25650 times.
✗ Branch 1 not taken.
|
25650 |
m_code(other.m_code), |
| 273 |
2/2
✓ Branch 0 taken 25640 times.
✓ Branch 1 taken 10 times.
|
25650 |
m_formula(other.m_formula), |
| 274 |
|
25650 |
m_mono(other.m_mono), |
| 275 |
2/2
✓ Branch 2 taken 1 times.
✓ Branch 3 taken 25649 times.
|
51300 |
m_avg(other.m_avg) |
| 276 |
|
|
{ |
| 277 |
2/2
✓ Branch 0 taken 1 times.
✓ Branch 1 taken 25649 times.
|
25650 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 278 |
2/4
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
|
1 |
qCritical() << "Copy-constructing Monomer with no PolChemDef."; |
| 279 |
|
|
|
| 280 |
|
|
// We do a real duplication of the Modif instances. |
| 281 |
2/2
✓ Branch 1 taken 9 times.
✓ Branch 2 taken 25650 times.
|
25659 |
for(ModifSPtr modif_sp : other.m_modifs) |
| 282 |
4/10
✓ Branch 1 taken 9 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 9 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 9 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 9 times.
✗ Branch 9 not taken.
✗ Branch 10 not taken.
✗ Branch 11 not taken.
|
36 |
storeModif(std::make_shared<Modif>(*modif_sp)); |
| 283 |
|
|
|
| 284 |
|
25650 |
ErrorList error_list; |
| 285 |
1/2
✓ Branch 1 taken 25650 times.
✗ Branch 2 not taken.
|
25650 |
m_isValid = validate(&error_list); |
| 286 |
|
|
|
| 287 |
2/2
✓ Branch 0 taken 11 times.
✓ Branch 1 taken 25639 times.
|
25650 |
if(!m_isValid) |
| 288 |
|
|
{ |
| 289 |
2/4
✓ Branch 1 taken 11 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 11 times.
✗ Branch 5 not taken.
|
22 |
qCritical() << "Copy-construction of Monomer with validation errors:\n" |
| 290 |
3/6
✓ Branch 1 taken 11 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 11 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 11 times.
✗ Branch 8 not taken.
|
22 |
<< Utils::joinErrorList(error_list, ", "); |
| 291 |
|
|
} |
| 292 |
0/2
✗ Branch 5 not taken.
✗ Branch 6 not taken.
|
25650 |
} |
| 293 |
|
|
|
| 294 |
|
|
/*! |
| 295 |
|
|
\brief Destroys the monomer. |
| 296 |
|
|
*/ |
| 297 |
|
91462 |
Monomer::~Monomer() |
| 298 |
|
|
{ |
| 299 |
|
91462 |
m_modifs.clear(); |
| 300 |
2/2
✓ Branch 5 taken 45725 times.
✓ Branch 6 taken 6 times.
|
182912 |
} |
| 301 |
|
|
|
| 302 |
|
|
|
| 303 |
|
|
//////////////// THE POLCHEMDEF ///////////////////// |
| 304 |
|
|
/*! |
| 305 |
|
|
\brief Sets the polymer chemistry definition to \a pol_chem_def_csp. |
| 306 |
|
|
*/ |
| 307 |
|
|
void |
| 308 |
|
4 |
Monomer::setPolChemDefCstSPtr(PolChemDefCstSPtr &pol_chem_def_csp) |
| 309 |
|
|
{ |
| 310 |
|
4 |
mcsp_polChemDef = pol_chem_def_csp; |
| 311 |
|
|
|
| 312 |
|
4 |
ErrorList error_list; |
| 313 |
1/2
✓ Branch 1 taken 4 times.
✗ Branch 2 not taken.
|
4 |
m_isValid = validate(&error_list); |
| 314 |
|
|
|
| 315 |
1/2
✓ Branch 0 taken 4 times.
✗ Branch 1 not taken.
|
4 |
if(!m_isValid) |
| 316 |
2/4
✓ Branch 1 taken 4 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 4 times.
✗ Branch 5 not taken.
|
8 |
qCritical() << "Failed to validate the Monomer with errors:\n" |
| 317 |
3/6
✓ Branch 1 taken 4 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 4 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 4 times.
✗ Branch 8 not taken.
|
8 |
<< Utils::joinErrorList(error_list, ", "); |
| 318 |
|
4 |
} |
| 319 |
|
|
|
| 320 |
|
|
/*! |
| 321 |
|
|
\brief Returns the polymer chemistry definition. |
| 322 |
|
|
*/ |
| 323 |
|
|
const PolChemDefCstSPtr & |
| 324 |
|
14 |
Monomer::getPolChemDefCstSPtr() const |
| 325 |
|
|
{ |
| 326 |
|
14 |
return mcsp_polChemDef; |
| 327 |
|
|
} |
| 328 |
|
|
|
| 329 |
|
|
//////////////// THE NAME ///////////////////// |
| 330 |
|
|
|
| 331 |
|
|
/*! |
| 332 |
|
|
\brief Sets the \a name. |
| 333 |
|
|
*/ |
| 334 |
|
|
void |
| 335 |
|
4 |
Monomer::setName(const QString &name) |
| 336 |
|
|
{ |
| 337 |
|
4 |
m_name = name; |
| 338 |
|
|
|
| 339 |
|
4 |
ErrorList error_list; |
| 340 |
1/2
✓ Branch 1 taken 4 times.
✗ Branch 2 not taken.
|
4 |
m_isValid = validate(&error_list); |
| 341 |
|
|
|
| 342 |
2/2
✓ Branch 0 taken 3 times.
✓ Branch 1 taken 1 times.
|
4 |
if(!m_isValid) |
| 343 |
2/4
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 3 times.
✗ Branch 5 not taken.
|
6 |
qCritical() << "Failed to validate the Monomer with errors:\n" |
| 344 |
3/6
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 3 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 3 times.
✗ Branch 8 not taken.
|
6 |
<< Utils::joinErrorList(error_list, ", "); |
| 345 |
|
4 |
} |
| 346 |
|
|
|
| 347 |
|
|
/*! |
| 348 |
|
|
\brief Returns the name. |
| 349 |
|
|
*/ |
| 350 |
|
|
QString |
| 351 |
|
236 |
Monomer::getName() const |
| 352 |
|
|
{ |
| 353 |
2/2
✓ Branch 0 taken 232 times.
✓ Branch 1 taken 4 times.
|
236 |
return m_name; |
| 354 |
|
|
} |
| 355 |
|
|
|
| 356 |
|
|
|
| 357 |
|
|
//////////////// THE CODE ///////////////////// |
| 358 |
|
|
/*! |
| 359 |
|
|
\brief Sets the code to \a code |
| 360 |
|
|
|
| 361 |
|
|
*/ |
| 362 |
|
|
void |
| 363 |
|
14 |
Monomer::setCode(const QString &code) |
| 364 |
|
|
{ |
| 365 |
|
14 |
m_code = code; |
| 366 |
|
|
|
| 367 |
|
14 |
ErrorList error_list; |
| 368 |
1/2
✓ Branch 1 taken 14 times.
✗ Branch 2 not taken.
|
14 |
m_isValid = validate(&error_list); |
| 369 |
|
|
|
| 370 |
2/2
✓ Branch 0 taken 11 times.
✓ Branch 1 taken 3 times.
|
14 |
if(!m_isValid) |
| 371 |
2/4
✓ Branch 1 taken 11 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 11 times.
✗ Branch 5 not taken.
|
22 |
qCritical() << "Failed to validate the Monomer with errors:\n" |
| 372 |
3/6
✓ Branch 1 taken 11 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 11 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 11 times.
✗ Branch 8 not taken.
|
22 |
<< Utils::joinErrorList(error_list, ", "); |
| 373 |
|
14 |
} |
| 374 |
|
|
|
| 375 |
|
|
|
| 376 |
|
|
/*! |
| 377 |
|
|
\brief Returns the code |
| 378 |
|
|
*/ |
| 379 |
|
|
QString |
| 380 |
|
756418 |
Monomer::getCode() const |
| 381 |
|
|
{ |
| 382 |
2/2
✓ Branch 0 taken 756414 times.
✓ Branch 1 taken 4 times.
|
756418 |
return m_code; |
| 383 |
|
|
} |
| 384 |
|
|
|
| 385 |
|
|
|
| 386 |
|
|
/*! |
| 387 |
|
|
\brief Checks the code's syntactic validity. |
| 388 |
|
|
|
| 389 |
|
|
If \a code_length is not -1, then that length is used for the |
| 390 |
|
|
check. Otherwise, the length from the polymer chemistry definition (if |
| 391 |
|
|
available) is used. |
| 392 |
|
|
|
| 393 |
|
|
The monomer code is verified and has to verify these criteria: |
| 394 |
|
|
|
| 395 |
|
|
\list |
| 396 |
|
|
\li It must be non-empty |
| 397 |
|
|
\li Its character length has to be less or equal to the code length parameter |
| 398 |
|
|
in the polymer chemistry definition (see PolChemDef::m_codeLength) |
| 399 |
|
|
\li The first character is uppercase |
| 400 |
|
|
\li All the remaining characters are lowercase |
| 401 |
|
|
\endlist |
| 402 |
|
|
|
| 403 |
|
|
Returns true if the code syntax checked successfully, false otherwise. |
| 404 |
|
|
|
| 405 |
|
|
\sa validate() |
| 406 |
|
|
*/ |
| 407 |
|
|
bool |
| 408 |
|
80224 |
Monomer::checkCodeSyntax(int code_length) const |
| 409 |
|
|
{ |
| 410 |
|
80224 |
int local_code_length = code_length; |
| 411 |
|
|
|
| 412 |
1/2
✓ Branch 0 taken 80224 times.
✗ Branch 1 not taken.
|
80224 |
if(local_code_length == -1) |
| 413 |
|
|
{ |
| 414 |
2/2
✓ Branch 0 taken 80220 times.
✓ Branch 1 taken 4 times.
|
80224 |
if(mcsp_polChemDef != nullptr || mcsp_polChemDef.get() != nullptr) |
| 415 |
|
|
{ |
| 416 |
|
80220 |
local_code_length = mcsp_polChemDef->getCodeLength(); |
| 417 |
|
|
} |
| 418 |
|
|
else |
| 419 |
|
|
{ |
| 420 |
|
8 |
qCritical() << "Checking code syntax with unlimited length because " |
| 421 |
1/2
✓ Branch 1 taken 4 times.
✗ Branch 2 not taken.
|
4 |
"Monomer has no PolChemDef."; |
| 422 |
|
4 |
local_code_length = 1000; |
| 423 |
|
|
} |
| 424 |
|
|
} |
| 425 |
|
|
|
| 426 |
|
|
// qDebug() << "Checking code syntax:" << m_code |
| 427 |
|
|
// << "with code length:" << local_code_length; |
| 428 |
|
|
|
| 429 |
|
|
// The code has to be at least one character long. |
| 430 |
|
|
|
| 431 |
|
|
// The first letter in the code has to be uppercase. |
| 432 |
|
|
// All the remaining authorized characters have to be |
| 433 |
|
|
// lowercase. |
| 434 |
|
|
|
| 435 |
4/4
✓ Branch 0 taken 80157 times.
✓ Branch 1 taken 67 times.
✓ Branch 2 taken 80149 times.
✓ Branch 3 taken 8 times.
|
80224 |
if(m_code.length() < 1 || m_code.length() > local_code_length) |
| 436 |
|
|
{ |
| 437 |
2/4
✓ Branch 2 taken 75 times.
✗ Branch 3 not taken.
✓ Branch 5 taken 75 times.
✗ Branch 6 not taken.
|
150 |
qCritical() << "The code has a length:" << m_code.length() |
| 438 |
1/2
✓ Branch 1 taken 75 times.
✗ Branch 2 not taken.
|
75 |
<< "that does not match the expected code length:" |
| 439 |
1/2
✓ Branch 1 taken 75 times.
✗ Branch 2 not taken.
|
75 |
<< local_code_length; |
| 440 |
|
75 |
m_isValid = false; |
| 441 |
|
75 |
return false; |
| 442 |
|
|
} |
| 443 |
|
|
|
| 444 |
|
|
// Note that the actual monomer code length might be less than the |
| 445 |
|
|
// codeLength member datum in the polymer chemistry |
| 446 |
|
|
// definition. |
| 447 |
|
|
|
| 448 |
|
80149 |
QString regexp_string = |
| 449 |
1/2
✓ Branch 2 taken 80149 times.
✗ Branch 3 not taken.
|
80149 |
QString("([A-Z])([a-z]{0,%1})").arg(local_code_length - 1); |
| 450 |
1/2
✓ Branch 1 taken 80149 times.
✗ Branch 2 not taken.
|
80149 |
QRegularExpression regexp(regexp_string); |
| 451 |
1/2
✓ Branch 1 taken 80149 times.
✗ Branch 2 not taken.
|
80149 |
QRegularExpressionMatch match = regexp.match(m_code); |
| 452 |
|
|
|
| 453 |
1/2
✓ Branch 1 taken 80149 times.
✗ Branch 2 not taken.
|
80149 |
if(match.hasMatch()) |
| 454 |
|
|
{ |
| 455 |
|
|
// qDebug() << "First uppercase char:" << match.captured(1); |
| 456 |
|
|
// qDebug() << "Remaining lowercase chars:" << match.captured(2); |
| 457 |
|
|
|
| 458 |
|
|
return true; |
| 459 |
|
|
} |
| 460 |
|
|
else |
| 461 |
|
|
{ |
| 462 |
|
|
qDebug() << "Failed to RegExp match the monomer code:" << m_code |
| 463 |
|
|
<< "against an expected code length of:" << local_code_length; |
| 464 |
|
|
} |
| 465 |
|
|
|
| 466 |
|
|
return false; |
| 467 |
|
|
|
| 468 |
|
|
#if 0 |
| 469 |
|
|
// Old version |
| 470 |
|
|
for(int iter = 0; iter < m_code.size(); ++iter) |
| 471 |
|
|
{ |
| 472 |
|
|
// Test that the m_code length is not greater than codeLength. |
| 473 |
|
|
if(iter + 1 > codeLength) |
| 474 |
|
|
{ |
| 475 |
|
|
PolChemDefEntity::m_isValid = false; |
| 476 |
|
|
return false; |
| 477 |
|
|
} |
| 478 |
|
|
|
| 479 |
|
|
// And now check the character syntax. |
| 480 |
|
|
QChar curChar = m_code.at(iter); |
| 481 |
|
|
|
| 482 |
|
|
if(iter == 0) |
| 483 |
|
|
{ |
| 484 |
|
|
if(curChar.category() != QChar::Letter_Uppercase) |
| 485 |
|
|
{ |
| 486 |
|
|
PolChemDefEntity::m_isValid = false; |
| 487 |
|
|
return false; |
| 488 |
|
|
} |
| 489 |
|
|
} |
| 490 |
|
|
else if(curChar.category() == QChar::Letter_Uppercase) |
| 491 |
|
|
{ |
| 492 |
|
|
PolChemDefEntity::m_isValid = false; |
| 493 |
|
|
return false; |
| 494 |
|
|
} |
| 495 |
|
|
} |
| 496 |
|
|
|
| 497 |
|
|
return true; |
| 498 |
|
|
#endif |
| 499 |
|
80149 |
} |
| 500 |
|
|
|
| 501 |
|
|
//////////////// THE FORMULA ///////////////////// |
| 502 |
|
|
|
| 503 |
|
|
/*! |
| 504 |
|
|
\brief Sets the formula to \a formula_string. |
| 505 |
|
|
*/ |
| 506 |
|
|
void |
| 507 |
|
3 |
Monomer::setFormula(const QString &formula_string) |
| 508 |
|
|
{ |
| 509 |
|
3 |
m_formula = formula_string; |
| 510 |
|
|
|
| 511 |
|
3 |
ErrorList error_list; |
| 512 |
1/2
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
|
3 |
m_isValid = validate(&error_list); |
| 513 |
|
|
|
| 514 |
2/2
✓ Branch 0 taken 1 times.
✓ Branch 1 taken 2 times.
|
3 |
if(!m_isValid) |
| 515 |
2/4
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
|
2 |
qCritical() << "Failed to validate the Monomer with errors:\n" |
| 516 |
3/6
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
|
2 |
<< Utils::joinErrorList(error_list, ", "); |
| 517 |
|
3 |
} |
| 518 |
|
|
|
| 519 |
|
|
/* |
| 520 |
|
|
\brief Returns the formula of this Monomer. |
| 521 |
|
|
*/ |
| 522 |
|
|
const QString & |
| 523 |
|
7366 |
Monomer::getFormula() const |
| 524 |
|
|
{ |
| 525 |
|
7366 |
return m_formula; |
| 526 |
|
|
} |
| 527 |
|
|
|
| 528 |
|
|
|
| 529 |
|
|
//////////////// THE MODIFICATIONS ///////////////////// |
| 530 |
|
|
|
| 531 |
|
|
/*! |
| 532 |
|
|
\brief Returns the container of Modif instances that modify this Monomer. |
| 533 |
|
|
*/ |
| 534 |
|
|
const std::vector<ModifSPtr> & |
| 535 |
|
603 |
Monomer::getModifsCstRef() const |
| 536 |
|
|
{ |
| 537 |
|
603 |
return m_modifs; |
| 538 |
|
|
} |
| 539 |
|
|
|
| 540 |
|
|
|
| 541 |
|
|
/*! |
| 542 |
|
|
\brief Returns the list of Modif names in the same order as the Modif instances |
| 543 |
|
|
are stored in the member container. |
| 544 |
|
|
*/ |
| 545 |
|
|
std::vector<QString> |
| 546 |
|
✗ |
Monomer::modifNamesInOrder() const |
| 547 |
|
|
{ |
| 548 |
|
✗ |
std::vector<QString> names; |
| 549 |
|
|
|
| 550 |
|
✗ |
for(const ModifSPtr &modif_sp : m_modifs) |
| 551 |
|
✗ |
names.push_back(modif_sp->getName()); |
| 552 |
|
|
|
| 553 |
|
✗ |
return names; |
| 554 |
|
✗ |
} |
| 555 |
|
|
|
| 556 |
|
|
|
| 557 |
|
|
/* |
| 558 |
|
|
\brief Returns true if this monomer is a target of Modif \a modif, false |
| 559 |
|
|
otherwise. |
| 560 |
|
|
*/ |
| 561 |
|
|
bool |
| 562 |
|
468 |
Monomer::isModifTarget(const Modif &modif) const |
| 563 |
|
|
{ |
| 564 |
|
|
// Pure convenience function. |
| 565 |
|
|
// qDebug() << "The modif:" << modif.toString(); |
| 566 |
|
|
|
| 567 |
|
468 |
return modif.doesTargetMonomer(m_code); |
| 568 |
|
|
} |
| 569 |
|
|
|
| 570 |
|
|
|
| 571 |
|
|
/*! |
| 572 |
|
|
\brief Modifies this monomer using \a modif. |
| 573 |
|
|
|
| 574 |
|
|
These two verifications that are done: |
| 575 |
|
|
|
| 576 |
|
|
\list |
| 577 |
|
|
|
| 578 |
|
|
\li This monomer must be a target of \a modif; |
| 579 |
|
|
|
| 580 |
|
|
\li The count of \a modif modifications in this monomer must be at most the |
| 581 |
|
|
authorized count - 1, to accomodate this new modification [see |
| 582 |
|
|
Modif::maxCount()]. |
| 583 |
|
|
|
| 584 |
|
|
\endlist |
| 585 |
|
|
|
| 586 |
|
|
The two restrictions above can be overridden by setting \a override to true. |
| 587 |
|
|
|
| 588 |
|
|
If errors are encountered, these are reported as strings in \a error_list_p. |
| 589 |
|
|
|
| 590 |
|
|
Returns a string with the Uuid of the allocated Modif instance. |
| 591 |
|
|
*/ |
| 592 |
|
|
QString |
| 593 |
|
136 |
Monomer::modify(const Modif &modif, bool override, ErrorList *error_list_p) |
| 594 |
|
|
{ |
| 595 |
3/4
✓ Branch 1 taken 2 times.
✓ Branch 2 taken 134 times.
✓ Branch 3 taken 2 times.
✗ Branch 4 not taken.
|
136 |
if(!isModifTarget(modif) && !override) |
| 596 |
|
|
{ |
| 597 |
|
|
// This monomer is not a target for the modif, and no override |
| 598 |
|
|
// is allowed. |
| 599 |
|
|
|
| 600 |
|
2 |
error_list_p->push_back( |
| 601 |
|
2 |
QString("%1 not target of Modif %2 (no overriding allowed)") |
| 602 |
1/2
✓ Branch 1 taken 2 times.
✗ Branch 2 not taken.
|
4 |
.arg(m_name) |
| 603 |
2/4
✓ Branch 1 taken 2 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 2 times.
✗ Branch 5 not taken.
|
4 |
.arg(modif.getName())); |
| 604 |
|
|
|
| 605 |
|
2 |
return QString(); |
| 606 |
|
|
} |
| 607 |
|
|
|
| 608 |
|
134 |
qDebug() << "Good, the monomer is target of this modif."; |
| 609 |
|
|
|
| 610 |
1/2
✓ Branch 2 taken 134 times.
✗ Branch 3 not taken.
|
134 |
int count = countModifsByName(modif.getName()); |
| 611 |
|
|
|
| 612 |
|
134 |
qDebug() << "There are" << count << "modifs by that name."; |
| 613 |
|
|
|
| 614 |
4/4
✓ Branch 1 taken 13 times.
✓ Branch 2 taken 121 times.
✓ Branch 3 taken 5 times.
✓ Branch 4 taken 8 times.
|
134 |
if(count >= modif.getMaxCount() && !override) |
| 615 |
|
|
{ |
| 616 |
|
|
// This monomer has already the maximum count of 'modif' objects. |
| 617 |
|
|
|
| 618 |
|
8 |
error_list_p->push_back( |
| 619 |
|
8 |
QString("%1 already modified %2 times (no overriding allowed)") |
| 620 |
1/2
✓ Branch 1 taken 8 times.
✗ Branch 2 not taken.
|
16 |
.arg(m_name) |
| 621 |
2/4
✓ Branch 1 taken 8 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 8 times.
✗ Branch 5 not taken.
|
16 |
.arg(count)); |
| 622 |
|
|
|
| 623 |
|
8 |
return QString(); |
| 624 |
|
|
} |
| 625 |
|
|
|
| 626 |
|
|
// We do a real allocation of a new Modif instance. |
| 627 |
|
126 |
qDebug() << "Now allocating ModifSPtr:" << modif.getName() |
| 628 |
|
|
<< "and calling storeModifSPtrAsUuid with it."; |
| 629 |
|
|
|
| 630 |
|
126 |
ModifSPtr modif_sp = std::make_shared<Modif>(modif); |
| 631 |
|
|
|
| 632 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 126 times.
|
126 |
if(modif_sp == nullptr || modif_sp.get() == nullptr) |
| 633 |
|
✗ |
qFatalStream() << "Failed to allocated new Modif object."; |
| 634 |
|
|
|
| 635 |
1/2
✓ Branch 1 taken 126 times.
✗ Branch 2 not taken.
|
126 |
QString uuid = storeModif(modif_sp); |
| 636 |
|
|
|
| 637 |
|
126 |
qDebug() << "The stored Modif:" << uuid << getModifForUuid(uuid)->getName(); |
| 638 |
|
|
|
| 639 |
|
126 |
return uuid; |
| 640 |
1/2
✓ Branch 0 taken 126 times.
✗ Branch 1 not taken.
|
252 |
} |
| 641 |
|
|
|
| 642 |
|
|
|
| 643 |
|
|
/*! |
| 644 |
|
|
\brief Modifies this monomer using \a modif_name. |
| 645 |
|
|
|
| 646 |
|
|
\a modif_name is used to find a Modif instance in the polymer chemistry |
| 647 |
|
|
definition. |
| 648 |
|
|
|
| 649 |
|
|
If such a Modif is found, it is used to modify this Monomer. |
| 650 |
|
|
|
| 651 |
|
|
Returns a string with the Uuid of the allocated Modif instance. |
| 652 |
|
|
*/ |
| 653 |
|
|
QString |
| 654 |
|
2 |
Monomer::modify(const QString &modif_name, bool override, ErrorList *error_list_p) |
| 655 |
|
|
{ |
| 656 |
|
2 |
ModifCstSPtr modif_csp = mcsp_polChemDef->getModifCstSPtrByName(modif_name); |
| 657 |
|
|
|
| 658 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(modif_csp == nullptr) |
| 659 |
|
|
{ |
| 660 |
|
✗ |
qCritical() << "Modif by name" << modif_name << "is not known."; |
| 661 |
|
✗ |
return QString(); |
| 662 |
|
|
} |
| 663 |
|
|
|
| 664 |
1/2
✓ Branch 1 taken 2 times.
✗ Branch 2 not taken.
|
2 |
return modify(*modif_csp, override, error_list_p); |
| 665 |
|
2 |
} |
| 666 |
|
|
|
| 667 |
|
|
/*! |
| 668 |
|
|
\brief Removes from this monomer the Modif instance tagged using the Uuid \a |
| 669 |
|
|
uuid string. |
| 670 |
|
|
|
| 671 |
|
|
Returns true if the unmodification was actually performed, false otherwise. |
| 672 |
|
|
*/ |
| 673 |
|
|
bool |
| 674 |
|
13 |
Monomer::unmodify(const QString &uuid) |
| 675 |
|
|
{ |
| 676 |
1/2
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
|
13 |
std::vector<UuidModifWPtrPair>::iterator the_iterator = std::find_if( |
| 677 |
|
|
m_uuidModifPairs.begin(), |
| 678 |
|
|
m_uuidModifPairs.end(), |
| 679 |
8/22
✓ Branch 0 taken 4 times.
✗ Branch 1 not taken.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✗ Branch 4 not taken.
✗ Branch 5 not taken.
✗ Branch 6 not taken.
✗ Branch 7 not taken.
✓ Branch 8 taken 3 times.
✗ Branch 9 not taken.
✓ Branch 10 taken 2 times.
✗ Branch 11 not taken.
✓ Branch 12 taken 4 times.
✗ Branch 13 not taken.
✓ Branch 14 taken 13 times.
✗ Branch 15 not taken.
✓ Branch 17 taken 13 times.
✗ Branch 18 not taken.
✓ Branch 19 taken 13 times.
✗ Branch 20 not taken.
✓ Branch 22 taken 13 times.
✗ Branch 23 not taken.
|
130 |
[uuid](UuidModifWPtrPair &pair) { return pair.first == uuid; }); |
| 680 |
|
|
|
| 681 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 13 times.
|
13 |
if(the_iterator == m_uuidModifPairs.end()) |
| 682 |
|
|
{ |
| 683 |
|
✗ |
qCritical() << "The modification was not found."; |
| 684 |
|
✗ |
return false; |
| 685 |
|
|
} |
| 686 |
|
|
|
| 687 |
|
|
// Sanity check |
| 688 |
|
65 |
if((*the_iterator).second.expired() || |
| 689 |
5/10
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
✓ Branch 2 taken 13 times.
✗ Branch 3 not taken.
✓ Branch 5 taken 13 times.
✗ Branch 6 not taken.
✓ Branch 7 taken 13 times.
✗ Branch 8 not taken.
✗ Branch 9 not taken.
✓ Branch 10 taken 13 times.
|
39 |
(*the_iterator).second.lock() == nullptr || |
| 690 |
2/6
✓ Branch 2 taken 13 times.
✗ Branch 3 not taken.
✓ Branch 4 taken 13 times.
✗ Branch 5 not taken.
✗ Branch 6 not taken.
✗ Branch 7 not taken.
|
26 |
!hasModif((*the_iterator).second.lock())) |
| 691 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 692 |
|
|
|
| 693 |
3/6
✓ Branch 2 taken 13 times.
✗ Branch 3 not taken.
✓ Branch 4 taken 13 times.
✗ Branch 5 not taken.
✗ Branch 6 not taken.
✓ Branch 7 taken 13 times.
|
26 |
if(!removeModif((*the_iterator).second.lock())) |
| 694 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 695 |
|
|
|
| 696 |
|
|
return true; |
| 697 |
|
|
} |
| 698 |
|
|
|
| 699 |
|
|
|
| 700 |
|
|
/*! |
| 701 |
|
|
\brief Removes \e{all} the modification from this monomer. |
| 702 |
|
|
|
| 703 |
|
|
Returns true if at least one Modif instance was removed, false if this Monomer |
| 704 |
|
|
instance was not modified. |
| 705 |
|
|
*/ |
| 706 |
|
|
bool |
| 707 |
|
2 |
Monomer::unmodify() |
| 708 |
|
|
{ |
| 709 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
std::size_t modif_count = m_modifs.size(); |
| 710 |
|
|
|
| 711 |
|
|
// Sanity check |
| 712 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(m_modifs.size() != m_uuidModifPairs.size()) |
| 713 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 714 |
|
|
|
| 715 |
|
2 |
m_modifs.clear(); |
| 716 |
1/2
✓ Branch 0 taken 2 times.
✗ Branch 1 not taken.
|
2 |
m_uuidModifPairs.clear(); |
| 717 |
|
|
|
| 718 |
|
2 |
return modif_count != 0; |
| 719 |
|
|
} |
| 720 |
|
|
|
| 721 |
|
|
|
| 722 |
|
|
/*! |
| 723 |
|
|
\brief Returns true if this monomer has at least one modification, false |
| 724 |
|
|
otherwise. |
| 725 |
|
|
*/ |
| 726 |
|
|
bool |
| 727 |
|
16806 |
Monomer::isModified() const |
| 728 |
|
|
{ |
| 729 |
|
16806 |
return m_modifs.size(); |
| 730 |
|
|
} |
| 731 |
|
|
|
| 732 |
|
|
/*! |
| 733 |
|
|
\brief Returns the count of modifications by name \a modif_name in this |
| 734 |
|
|
monomer. |
| 735 |
|
|
*/ |
| 736 |
|
|
int |
| 737 |
|
143 |
Monomer::countModifsByName(const QString &modif_name) |
| 738 |
|
|
{ |
| 739 |
1/2
✓ Branch 0 taken 143 times.
✗ Branch 1 not taken.
|
143 |
int count = std::count_if( |
| 740 |
4/8
✓ Branch 0 taken 143 times.
✗ Branch 1 not taken.
✓ Branch 2 taken 143 times.
✗ Branch 3 not taken.
✓ Branch 5 taken 143 times.
✗ Branch 6 not taken.
✓ Branch 13 taken 143 times.
✗ Branch 14 not taken.
|
1001 |
m_modifs.begin(), m_modifs.end(), [modif_name](const ModifSPtr &modif_sp) { |
| 741 |
|
77 |
return modif_sp->getName() == modif_name; |
| 742 |
|
143 |
}); |
| 743 |
|
|
|
| 744 |
|
143 |
return count; |
| 745 |
|
|
} |
| 746 |
|
|
|
| 747 |
|
|
|
| 748 |
|
|
//////////////// OPERATORS ///////////////////// |
| 749 |
|
|
|
| 750 |
|
|
/*! |
| 751 |
|
|
\brief Assigns \a other's member data to this monomer. |
| 752 |
|
|
|
| 753 |
|
|
The copy is deep, in particular with the mpa_modifList being copied. |
| 754 |
|
|
|
| 755 |
|
|
Returns a reference to this monomer. |
| 756 |
|
|
*/ |
| 757 |
|
|
Monomer & |
| 758 |
|
25643 |
Monomer::operator=(const Monomer &other) |
| 759 |
|
|
{ |
| 760 |
1/2
✓ Branch 0 taken 25643 times.
✗ Branch 1 not taken.
|
25643 |
if(&other == this) |
| 761 |
|
|
return *this; |
| 762 |
|
|
|
| 763 |
|
25643 |
mcsp_polChemDef = other.mcsp_polChemDef; |
| 764 |
|
25643 |
m_name = other.m_name; |
| 765 |
|
25643 |
m_code = other.m_code; |
| 766 |
|
25643 |
m_formula = other.m_formula; |
| 767 |
|
25643 |
m_mono = other.m_mono; |
| 768 |
|
25643 |
m_avg = other.m_avg; |
| 769 |
|
|
|
| 770 |
|
|
// We want the modifs to be stored anew. So first clear. |
| 771 |
|
25643 |
m_modifs.clear(); |
| 772 |
|
|
|
| 773 |
|
|
// We do a real duplication of the Modif instances. |
| 774 |
2/2
✓ Branch 0 taken 2 times.
✓ Branch 1 taken 25643 times.
|
25645 |
for(const ModifSPtr &modif_sp : other.m_modifs) |
| 775 |
2/4
✓ Branch 2 taken 2 times.
✗ Branch 3 not taken.
✓ Branch 4 taken 2 times.
✗ Branch 5 not taken.
|
6 |
storeModif(std::make_shared<Modif>(*modif_sp)); |
| 776 |
|
|
|
| 777 |
|
25643 |
PropListHolder::operator=(other); |
| 778 |
|
|
|
| 779 |
|
25643 |
ErrorList error_list; |
| 780 |
|
|
|
| 781 |
1/2
✓ Branch 1 taken 25643 times.
✗ Branch 2 not taken.
|
25643 |
m_isValid = validate(&error_list); |
| 782 |
|
|
|
| 783 |
2/2
✓ Branch 0 taken 1 times.
✓ Branch 1 taken 25642 times.
|
25643 |
if(!m_isValid) |
| 784 |
|
|
{ |
| 785 |
2/4
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
|
2 |
qCritical() << "Assignment of Monomer with validation errors:\n" |
| 786 |
3/6
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
|
2 |
<< Utils::joinErrorList(error_list, ", "); |
| 787 |
|
|
} |
| 788 |
|
|
|
| 789 |
|
|
// qDebug() << "Assignment of Monomer produced *this Monomer:" << toString(); |
| 790 |
|
|
|
| 791 |
|
25643 |
return *this; |
| 792 |
|
25643 |
} |
| 793 |
|
|
|
| 794 |
|
|
|
| 795 |
|
|
/*! |
| 796 |
|
|
\brief Returns true if this monomer and \a other are identical, false |
| 797 |
|
|
otherwise. |
| 798 |
|
|
|
| 799 |
|
|
The comparison involves also the comparison of the Modif objects in |
| 800 |
|
|
mpa_modifList. |
| 801 |
|
|
*/ |
| 802 |
|
|
bool |
| 803 |
|
91 |
Monomer::operator==(const Monomer &other) const |
| 804 |
|
|
{ |
| 805 |
2/2
✓ Branch 0 taken 11 times.
✓ Branch 1 taken 80 times.
|
91 |
if(&other == this) |
| 806 |
|
|
return true; |
| 807 |
|
|
|
| 808 |
|
|
// We cannot compare the PolChemDef, because that would cause |
| 809 |
|
|
// an infinite loop: (each instance of this class in the PolChemDef would |
| 810 |
|
|
// try to compare the PolChemDef...). |
| 811 |
|
|
|
| 812 |
6/6
✓ Branch 0 taken 74 times.
✓ Branch 1 taken 6 times.
✓ Branch 2 taken 72 times.
✓ Branch 3 taken 2 times.
✓ Branch 4 taken 70 times.
✓ Branch 5 taken 2 times.
|
80 |
if(m_name != other.m_name || m_code != other.m_code || |
| 813 |
5/6
✓ Branch 0 taken 74 times.
✓ Branch 1 taken 6 times.
✓ Branch 2 taken 70 times.
✓ Branch 3 taken 2 times.
✓ Branch 4 taken 70 times.
✗ Branch 5 not taken.
|
152 |
m_formula != other.m_formula || m_mono != other.m_mono || |
| 814 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 70 times.
|
70 |
m_avg != other.m_avg) |
| 815 |
|
|
return false; |
| 816 |
|
|
|
| 817 |
2/2
✓ Branch 0 taken 4 times.
✓ Branch 1 taken 66 times.
|
70 |
if(m_modifs.size() != other.m_modifs.size()) |
| 818 |
|
|
{ |
| 819 |
|
|
// qDebug() << "The Modif containers have different sizes."; |
| 820 |
|
|
return false; |
| 821 |
|
|
} |
| 822 |
|
|
|
| 823 |
|
|
// We do a deep Modif instance comparison. |
| 824 |
2/2
✓ Branch 0 taken 64 times.
✓ Branch 1 taken 4 times.
|
68 |
for(std::size_t iter = 0; iter < m_modifs.size(); ++iter) |
| 825 |
|
|
{ |
| 826 |
3/4
✗ Branch 0 not taken.
✓ Branch 1 taken 4 times.
✓ Branch 3 taken 2 times.
✓ Branch 4 taken 2 times.
|
4 |
if(*m_modifs.at(iter) != *other.m_modifs.at(iter)) |
| 827 |
|
|
{ |
| 828 |
|
|
// qDebug() << "At least one Modif instance differs in both Monomer |
| 829 |
|
|
// instances."; |
| 830 |
|
|
return false; |
| 831 |
|
|
} |
| 832 |
|
|
} |
| 833 |
|
|
|
| 834 |
|
|
return true; |
| 835 |
|
|
} |
| 836 |
|
|
|
| 837 |
|
|
|
| 838 |
|
|
/*! |
| 839 |
|
|
\brief Returns true if \c this monomer and \a other differ, false |
| 840 |
|
|
otherwise. |
| 841 |
|
|
|
| 842 |
|
|
Returns the negated result of operator==(other). |
| 843 |
|
|
*/ |
| 844 |
|
|
bool |
| 845 |
|
1967 |
Monomer::operator!=(const Monomer &other) const |
| 846 |
|
|
{ |
| 847 |
2/2
✓ Branch 0 taken 73 times.
✓ Branch 1 taken 1894 times.
|
1967 |
if(&other == this) |
| 848 |
|
|
return false; |
| 849 |
|
|
|
| 850 |
|
73 |
return !operator==(other); |
| 851 |
|
|
} |
| 852 |
|
|
|
| 853 |
|
|
|
| 854 |
|
|
//////////////// VALIDATIONS ///////////////////// |
| 855 |
|
|
/*! |
| 856 |
|
|
\brief Returns the Monomer instance from the polymer chemistry definition |
| 857 |
|
|
registered in this instance. |
| 858 |
|
|
|
| 859 |
|
|
The key to search the Monomer is this instance's member name. |
| 860 |
|
|
|
| 861 |
|
|
If there is no PolChemDef available, nullptr is returned. |
| 862 |
|
|
|
| 863 |
|
|
If no Monomer instance is found by this instance's name, nullptr is returned. |
| 864 |
|
|
*/ |
| 865 |
|
|
MonomerSPtr |
| 866 |
|
2 |
Monomer::getFromPolChemDefByName() const |
| 867 |
|
|
{ |
| 868 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 869 |
|
✗ |
return nullptr; |
| 870 |
|
|
|
| 871 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(m_name.isEmpty()) |
| 872 |
|
✗ |
return nullptr; |
| 873 |
|
|
|
| 874 |
|
2 |
return mcsp_polChemDef->getMonomerCstSPtrByName(m_name); |
| 875 |
|
|
} |
| 876 |
|
|
|
| 877 |
|
|
/*! |
| 878 |
|
|
\brief Returns the Monomer instance from the polymer chemistry definition |
| 879 |
|
|
registered in this instance. |
| 880 |
|
|
|
| 881 |
|
|
The key to search the Monomer is this instance's member code. |
| 882 |
|
|
|
| 883 |
|
|
If there is no PolChemDef available, nullptr is returned. |
| 884 |
|
|
|
| 885 |
|
|
If no Monomer instance is found by this instance's code, nullptr is returned. |
| 886 |
|
|
*/ |
| 887 |
|
|
MonomerSPtr |
| 888 |
|
2 |
Monomer::getFromPolChemDefByCode() const |
| 889 |
|
|
{ |
| 890 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 891 |
|
✗ |
return nullptr; |
| 892 |
|
|
|
| 893 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 2 times.
|
2 |
if(m_code.isEmpty()) |
| 894 |
|
✗ |
return nullptr; |
| 895 |
|
|
|
| 896 |
|
2 |
return mcsp_polChemDef->getMonomerCstSPtrByCode(m_code); |
| 897 |
|
|
} |
| 898 |
|
|
|
| 899 |
|
|
/*! |
| 900 |
|
|
\brief Returns the status of this Monomer instance the polymer chemistry |
| 901 |
|
|
definition registered in this instance. |
| 902 |
|
|
|
| 903 |
|
|
The key to search the Monomer is this instance's member name. |
| 904 |
|
|
|
| 905 |
|
|
If there is no PolChemDef available, |
| 906 |
|
|
Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE is returned. |
| 907 |
|
|
|
| 908 |
|
|
If no Monomer instance is found by this instance's name, |
| 909 |
|
|
Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN is returned, otherwise |
| 910 |
|
|
Enums::PolChemDefEntityStatus::ENTITY_KNOWN is returned. |
| 911 |
|
|
*/ |
| 912 |
|
|
Enums::PolChemDefEntityStatus |
| 913 |
|
7 |
Monomer::isKnownByNameInPolChemDef() const |
| 914 |
|
|
{ |
| 915 |
2/2
✓ Branch 0 taken 6 times.
✓ Branch 1 taken 1 times.
|
7 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 916 |
|
|
return Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE; |
| 917 |
|
|
|
| 918 |
4/4
✓ Branch 1 taken 4 times.
✓ Branch 2 taken 2 times.
✓ Branch 3 taken 4 times.
✓ Branch 4 taken 2 times.
|
10 |
if(mcsp_polChemDef->getMonomerCstSPtrByName(m_name) != nullptr) |
| 919 |
|
4 |
return Enums::PolChemDefEntityStatus::ENTITY_KNOWN; |
| 920 |
|
|
|
| 921 |
|
|
return Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN; |
| 922 |
|
|
} |
| 923 |
|
|
|
| 924 |
|
|
/*! |
| 925 |
|
|
\brief Returns the status of this Monomer instance the polymer chemistry |
| 926 |
|
|
definition registered in this instance. |
| 927 |
|
|
|
| 928 |
|
|
The key to search the Monomer is this instance's member code. |
| 929 |
|
|
|
| 930 |
|
|
If there is no PolChemDef available, |
| 931 |
|
|
Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE is returned. |
| 932 |
|
|
|
| 933 |
|
|
If no Monomer instance is found by this instance's code, |
| 934 |
|
|
Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN is returned, otherwise |
| 935 |
|
|
Enums::PolChemDefEntityStatus::ENTITY_KNOWN is returned. |
| 936 |
|
|
*/ |
| 937 |
|
|
Enums::PolChemDefEntityStatus |
| 938 |
|
40067 |
Monomer::isKnownByCodeInPolChemDef() const |
| 939 |
|
|
{ |
| 940 |
1/2
✓ Branch 0 taken 40067 times.
✗ Branch 1 not taken.
|
40067 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr) |
| 941 |
|
|
return Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE; |
| 942 |
|
|
|
| 943 |
4/4
✓ Branch 1 taken 40066 times.
✓ Branch 2 taken 1 times.
✓ Branch 3 taken 40066 times.
✓ Branch 4 taken 1 times.
|
80133 |
if(mcsp_polChemDef->getMonomerCstSPtrByCode(m_code) != nullptr) |
| 944 |
|
40066 |
return Enums::PolChemDefEntityStatus::ENTITY_KNOWN; |
| 945 |
|
|
|
| 946 |
|
|
return Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN; |
| 947 |
|
|
} |
| 948 |
|
|
|
| 949 |
|
|
|
| 950 |
|
|
/*! |
| 951 |
|
|
\brief Returns true if this monomer is valid, false otherwise. |
| 952 |
|
|
|
| 953 |
|
|
Validation of the monomer occurs if: |
| 954 |
|
|
|
| 955 |
|
|
\list |
| 956 |
|
|
\li Its name is not empty |
| 957 |
|
|
\li Its code is not empty and its syntax is correct |
| 958 |
|
|
\li Its formula validates |
| 959 |
|
|
\li Its modifications (if any) validate |
| 960 |
|
|
\endlist |
| 961 |
|
|
|
| 962 |
|
|
If errors are encountered, describing message are stored in \a error_list_p. |
| 963 |
|
|
|
| 964 |
|
|
\sa checkCodeSyntax() |
| 965 |
|
|
*/ |
| 966 |
|
|
bool |
| 967 |
|
78797 |
Monomer::validate(ErrorList *error_list_p) const |
| 968 |
|
|
{ |
| 969 |
2/2
✓ Branch 0 taken 78788 times.
✓ Branch 1 taken 9 times.
|
78797 |
qsizetype error_count = error_list_p->size(); |
| 970 |
|
|
|
| 971 |
3/4
✓ Branch 0 taken 78788 times.
✓ Branch 1 taken 9 times.
✓ Branch 2 taken 78788 times.
✗ Branch 3 not taken.
|
157585 |
if(mcsp_polChemDef == nullptr || mcsp_polChemDef.get() == nullptr || |
| 972 |
5/8
✓ Branch 1 taken 78788 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 78788 times.
✗ Branch 4 not taken.
✓ Branch 5 taken 78788 times.
✗ Branch 6 not taken.
✓ Branch 7 taken 9 times.
✓ Branch 8 taken 78788 times.
|
236373 |
mcsp_polChemDef->getIsotopicDataCstSPtr() == nullptr || |
| 973 |
8/14
✓ Branch 0 taken 78788 times.
✓ Branch 1 taken 9 times.
✓ Branch 3 taken 78788 times.
✗ Branch 4 not taken.
✓ Branch 5 taken 78788 times.
✗ Branch 6 not taken.
✓ Branch 8 taken 78788 times.
✗ Branch 9 not taken.
✓ Branch 10 taken 78788 times.
✗ Branch 11 not taken.
✓ Branch 12 taken 78788 times.
✓ Branch 13 taken 9 times.
✗ Branch 14 not taken.
✗ Branch 15 not taken.
|
315170 |
mcsp_polChemDef->getIsotopicDataCstSPtr().get() == nullptr || |
| 974 |
4/8
✓ Branch 1 taken 78788 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 78788 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 78788 times.
✓ Branch 7 taken 9 times.
✗ Branch 8 not taken.
✗ Branch 9 not taken.
|
157585 |
!mcsp_polChemDef->getIsotopicDataCstSPtr()->size()) |
| 975 |
|
|
{ |
| 976 |
|
18 |
error_list_p->push_back("The PolChemDef or IsotopicData are not available"); |
| 977 |
|
18 |
qCritical() |
| 978 |
|
|
<< "The polymer chemistry definition member datum is nullptr or " |
| 979 |
|
|
"its isotopic data are be either nullptr or empty. Monomer " |
| 980 |
|
|
"validation " |
| 981 |
1/2
✓ Branch 1 taken 9 times.
✗ Branch 2 not taken.
|
9 |
"failed."; |
| 982 |
|
|
|
| 983 |
|
9 |
m_isValid = false; |
| 984 |
|
9 |
return false; |
| 985 |
|
|
} |
| 986 |
|
|
|
| 987 |
2/2
✓ Branch 0 taken 25648 times.
✓ Branch 1 taken 53140 times.
|
78788 |
if(m_name.isEmpty()) |
| 988 |
|
|
{ |
| 989 |
1/2
✓ Branch 2 taken 25648 times.
✗ Branch 3 not taken.
|
25648 |
qCritical() << "The Monomer name is empty."; |
| 990 |
|
51296 |
error_list_p->push_back("The Monomer name is empty"); |
| 991 |
|
|
} |
| 992 |
|
|
|
| 993 |
|
|
// qDebug() << "Now checking the code syntax."; |
| 994 |
2/2
✓ Branch 1 taken 84 times.
✓ Branch 2 taken 78704 times.
|
78788 |
if(!checkCodeSyntax()) |
| 995 |
|
|
{ |
| 996 |
1/2
✓ Branch 2 taken 84 times.
✗ Branch 3 not taken.
|
84 |
qCritical() << "The Monomer code does not pass the syntax test."; |
| 997 |
|
168 |
error_list_p->push_back("The Monomer code does not pass the syntax test"); |
| 998 |
|
|
} |
| 999 |
|
|
|
| 1000 |
|
78788 |
Formula temp_formula(m_formula); |
| 1001 |
5/8
✓ Branch 1 taken 78788 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 78788 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 78788 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 25678 times.
✓ Branch 9 taken 53110 times.
|
157576 |
if(!temp_formula.validate(mcsp_polChemDef->getIsotopicDataCstSPtr(), |
| 1002 |
|
|
error_list_p)) |
| 1003 |
|
|
{ |
| 1004 |
2/4
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25678 times.
✗ Branch 5 not taken.
|
25678 |
qCritical() << "The Monomer formula failed to validate."; |
| 1005 |
1/2
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
|
51356 |
error_list_p->push_back("The Monomer formula failed to validate"); |
| 1006 |
|
|
} |
| 1007 |
|
|
|
| 1008 |
|
78788 |
double mono = 0.0; |
| 1009 |
|
78788 |
double avg = 0.0; |
| 1010 |
|
|
|
| 1011 |
5/8
✓ Branch 1 taken 78788 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 78788 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 78788 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 25678 times.
✓ Branch 9 taken 53110 times.
|
157576 |
if(!calculateMasses(mcsp_polChemDef->getIsotopicDataCstSPtr(), mono, avg)) |
| 1012 |
|
|
{ |
| 1013 |
2/4
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25678 times.
✗ Branch 5 not taken.
|
25678 |
qCritical() << "Failed to calculate the Monomer masses."; |
| 1014 |
1/2
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
|
51356 |
error_list_p->push_back("Failed to calculate the Monomer masses"); |
| 1015 |
|
|
} |
| 1016 |
|
|
|
| 1017 |
|
|
// qDebug() << qSetRealNumberPrecision(6) |
| 1018 |
|
|
// << "Validation calculated masses (not member data):" << mono << "-" |
| 1019 |
|
|
// << avg; |
| 1020 |
|
|
|
| 1021 |
2/2
✓ Branch 0 taken 19 times.
✓ Branch 1 taken 78788 times.
|
78807 |
for(const ModifSPtr &modif_sp : m_modifs) |
| 1022 |
|
|
{ |
| 1023 |
|
19 |
ErrorList local_error_list; |
| 1024 |
3/4
✓ Branch 1 taken 19 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✓ Branch 4 taken 18 times.
|
19 |
if(!modif_sp->validate(&local_error_list)) |
| 1025 |
|
|
{ |
| 1026 |
4/8
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
✓ Branch 10 taken 1 times.
✗ Branch 11 not taken.
|
2 |
qCritical() << "Monomer's Modif" << modif_sp->getName() |
| 1027 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
<< "failed to validate successfully."; |
| 1028 |
|
|
|
| 1029 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
2 |
error_list_p->push_back(QString("Failed to validate Monomer's Modif %1") |
| 1030 |
2/4
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
|
2 |
.arg(modif_sp->getName())); |
| 1031 |
|
|
} |
| 1032 |
|
19 |
} |
| 1033 |
|
|
|
| 1034 |
|
|
// If we added errors, then that means that the Monomer was not valid. |
| 1035 |
|
78788 |
m_isValid = (error_list_p->size() > error_count ? false : true); |
| 1036 |
|
|
|
| 1037 |
|
78788 |
return m_isValid; |
| 1038 |
|
78788 |
} |
| 1039 |
|
|
|
| 1040 |
|
|
/*! |
| 1041 |
|
|
\brief Returns the validity status of this Monomer. |
| 1042 |
|
|
|
| 1043 |
|
|
\sa validate() |
| 1044 |
|
|
*/ |
| 1045 |
|
|
bool |
| 1046 |
|
1473 |
Monomer::isValid() const |
| 1047 |
|
|
{ |
| 1048 |
|
1473 |
return m_isValid; |
| 1049 |
|
|
} |
| 1050 |
|
|
|
| 1051 |
|
|
|
| 1052 |
|
|
//////////////// MASS OPERATIONS ///////////////////// |
| 1053 |
|
|
|
| 1054 |
|
|
/*! |
| 1055 |
|
|
\brief Calculates this monomer's monoisotopic and avg masses and sets the |
| 1056 |
|
|
results to \a mono and \a avg. |
| 1057 |
|
|
|
| 1058 |
|
|
The calculation is performed by computing the masses of this monomer's formula, |
| 1059 |
|
|
accounting the chemical entities defined by \a monomer_chemical_entities. |
| 1060 |
|
|
|
| 1061 |
|
|
The calculations are performed using reference data in \a isotopic_data_csp. |
| 1062 |
|
|
|
| 1063 |
|
|
Returns true if the calculations were successful, false otherwise. |
| 1064 |
|
|
|
| 1065 |
|
|
\sa Formula::accountMasses() |
| 1066 |
|
|
*/ |
| 1067 |
|
|
bool |
| 1068 |
|
78792 |
Monomer::calculateMasses(const IsotopicDataCstSPtr &isotopic_data_csp, |
| 1069 |
|
|
double &mono, |
| 1070 |
|
|
double &avg, |
| 1071 |
|
|
Enums::ChemicalEntity monomer_chemical_entities) const |
| 1072 |
|
|
{ |
| 1073 |
|
78792 |
IsotopicDataCstSPtr local_isotopic_data_csp = isotopic_data_csp; |
| 1074 |
|
|
|
| 1075 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 78792 times.
|
78792 |
if(local_isotopic_data_csp == nullptr || |
| 1076 |
|
|
local_isotopic_data_csp.get() == nullptr) |
| 1077 |
|
|
{ |
| 1078 |
|
✗ |
if(mcsp_polChemDef != nullptr) |
| 1079 |
|
✗ |
local_isotopic_data_csp = mcsp_polChemDef->getIsotopicDataCstSPtr(); |
| 1080 |
|
|
|
| 1081 |
|
✗ |
if(local_isotopic_data_csp == nullptr || |
| 1082 |
|
|
local_isotopic_data_csp.get() == nullptr) |
| 1083 |
|
|
{ |
| 1084 |
|
✗ |
qCritical() << "Failed to find usable isotopic data."; |
| 1085 |
|
✗ |
m_isValid = false; |
| 1086 |
|
✗ |
return m_isValid; |
| 1087 |
|
|
} |
| 1088 |
|
|
} |
| 1089 |
|
|
|
| 1090 |
|
78792 |
mono = 0; |
| 1091 |
|
78792 |
avg = 0; |
| 1092 |
|
|
|
| 1093 |
|
78792 |
bool ok; |
| 1094 |
|
|
|
| 1095 |
|
|
// Formula temp_formula(m_formula); |
| 1096 |
2/4
✓ Branch 1 taken 78792 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 78792 times.
✗ Branch 5 not taken.
|
236376 |
Formula(m_formula).accountMasses(ok, local_isotopic_data_csp, mono, avg); |
| 1097 |
|
|
|
| 1098 |
2/2
✓ Branch 0 taken 25678 times.
✓ Branch 1 taken 53114 times.
|
78792 |
if(!ok) |
| 1099 |
|
|
{ |
| 1100 |
3/8
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25678 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 25678 times.
✗ Branch 8 not taken.
✗ Branch 11 not taken.
✗ Branch 12 not taken.
|
51356 |
qCritical() << "Failed accounting masses for Monomer:" << m_name |
| 1101 |
2/4
✓ Branch 1 taken 25678 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 25678 times.
✗ Branch 5 not taken.
|
25678 |
<< "and formula:" << m_formula; |
| 1102 |
|
25678 |
m_isValid = false; |
| 1103 |
|
25678 |
return m_isValid; |
| 1104 |
|
|
} |
| 1105 |
|
|
|
| 1106 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 53114 times.
|
53114 |
if(static_cast<int>(monomer_chemical_entities) & |
| 1107 |
|
|
static_cast<int>(Enums::ChemicalEntity::MODIF)) |
| 1108 |
|
|
{ |
| 1109 |
|
✗ |
for(const ModifSPtr &modif_sp : m_modifs) |
| 1110 |
|
✗ |
modif_sp->accountMasses(mono, avg, /*times*/ 1); |
| 1111 |
|
|
} |
| 1112 |
|
|
|
| 1113 |
|
|
return true; |
| 1114 |
|
78792 |
} |
| 1115 |
|
|
|
| 1116 |
|
|
/*! |
| 1117 |
|
|
\brief Calculates this monomer's monoisotopic and avg masses. |
| 1118 |
|
|
|
| 1119 |
|
|
The calculation is performed by computing the masses |
| 1120 |
|
|
of this monomer's formula, accounting or not the entities described by \a |
| 1121 |
|
|
monomer_chemical_entities. |
| 1122 |
|
|
|
| 1123 |
|
|
The reference data for the computations are accessed at \a isotopic_data_csp. |
| 1124 |
|
|
|
| 1125 |
|
|
Returns true if the calculations were successful, false otherwise. |
| 1126 |
|
|
|
| 1127 |
|
|
\sa Formula::accountMasses() |
| 1128 |
|
|
*/ |
| 1129 |
|
|
bool |
| 1130 |
|
3887 |
Monomer::calculateMasses(const IsotopicDataCstSPtr &isotopic_data_csp, |
| 1131 |
|
|
Enums::ChemicalEntity monomer_chemical_entities) |
| 1132 |
|
|
{ |
| 1133 |
|
3887 |
IsotopicDataCstSPtr local_isotopic_data_csp = isotopic_data_csp; |
| 1134 |
|
|
|
| 1135 |
2/2
✓ Branch 0 taken 3885 times.
✓ Branch 1 taken 2 times.
|
3887 |
if(local_isotopic_data_csp == nullptr || |
| 1136 |
|
|
local_isotopic_data_csp.get() == nullptr) |
| 1137 |
|
|
{ |
| 1138 |
1/2
✓ Branch 0 taken 3885 times.
✗ Branch 1 not taken.
|
3885 |
if(mcsp_polChemDef != nullptr) |
| 1139 |
2/4
✓ Branch 1 taken 3885 times.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✓ Branch 4 taken 3885 times.
|
7770 |
local_isotopic_data_csp = mcsp_polChemDef->getIsotopicDataCstSPtr(); |
| 1140 |
|
|
|
| 1141 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 3885 times.
|
3885 |
if(local_isotopic_data_csp == nullptr || |
| 1142 |
|
|
local_isotopic_data_csp.get() == nullptr) |
| 1143 |
|
|
{ |
| 1144 |
|
✗ |
qCritical() << "Failed to find usable isotopic data."; |
| 1145 |
|
✗ |
m_isValid = false; |
| 1146 |
|
✗ |
return m_isValid; |
| 1147 |
|
|
} |
| 1148 |
|
|
} |
| 1149 |
|
|
|
| 1150 |
|
3887 |
m_mono = 0; |
| 1151 |
|
3887 |
m_avg = 0; |
| 1152 |
|
|
|
| 1153 |
|
3887 |
bool ok; |
| 1154 |
|
|
|
| 1155 |
|
|
// Formula temp_formula(m_formula); |
| 1156 |
2/4
✓ Branch 1 taken 3887 times.
✗ Branch 2 not taken.
✓ Branch 5 taken 3887 times.
✗ Branch 6 not taken.
|
7774 |
Formula(m_formula).accountMasses(ok, local_isotopic_data_csp, m_mono, m_avg); |
| 1157 |
|
|
|
| 1158 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 3887 times.
|
3887 |
if(!ok) |
| 1159 |
|
|
{ |
| 1160 |
|
✗ |
qCritical() << "Failed accounting masses for Monomer:" << m_name |
| 1161 |
|
✗ |
<< "and formula:" << m_formula; |
| 1162 |
|
✗ |
m_isValid = false; |
| 1163 |
|
✗ |
return m_isValid; |
| 1164 |
|
|
} |
| 1165 |
|
|
|
| 1166 |
|
|
// qDebug() << "After calculating the masses: the Monomer:" << toString(); |
| 1167 |
|
|
// qDebug() << "flags:" << static_cast<int>(monomer_chemical_entities) |
| 1168 |
|
|
// << chemicalEntityMap[monomer_chemical_entities]; |
| 1169 |
|
|
|
| 1170 |
2/2
✓ Branch 0 taken 2456 times.
✓ Branch 1 taken 1431 times.
|
3887 |
if(static_cast<int>(monomer_chemical_entities) & |
| 1171 |
|
|
static_cast<int>(Enums::ChemicalEntity::MODIF)) |
| 1172 |
|
|
{ |
| 1173 |
2/2
✓ Branch 0 taken 29 times.
✓ Branch 1 taken 2456 times.
|
2485 |
for(const ModifSPtr &modif_sp : m_modifs) |
| 1174 |
1/2
✓ Branch 1 taken 29 times.
✗ Branch 2 not taken.
|
29 |
modif_sp->accountMasses(&m_mono, &m_avg, /*times*/ 1); |
| 1175 |
|
|
} |
| 1176 |
|
|
|
| 1177 |
|
|
return true; |
| 1178 |
|
3887 |
} |
| 1179 |
|
|
|
| 1180 |
|
|
/*! |
| 1181 |
|
|
\brief Calculates this monomer's monoisotopic and avg masses. |
| 1182 |
|
|
|
| 1183 |
|
|
The calculation is performed by computing the masses |
| 1184 |
|
|
of this monomer's formula. |
| 1185 |
|
|
|
| 1186 |
|
|
If \a monomer_chemical_entities & MONOMER_CHEMENT_MODIF is true, then the |
| 1187 |
|
|
masses are updated to account for the mass of modifications. |
| 1188 |
|
|
|
| 1189 |
|
|
Set \a ok to true if the calculations were successful, false otherwise. |
| 1190 |
|
|
|
| 1191 |
|
|
Returns this object. |
| 1192 |
|
|
|
| 1193 |
|
|
\sa Formula::accountMasses() |
| 1194 |
|
|
*/ |
| 1195 |
|
|
Monomer & |
| 1196 |
|
2 |
Monomer::calculateMasses(bool &ok, |
| 1197 |
|
|
const IsotopicDataCstSPtr &isotopic_data_csp, |
| 1198 |
|
|
Enums::ChemicalEntity monomer_chemical_entities) |
| 1199 |
|
|
{ |
| 1200 |
|
2 |
ok = calculateMasses(isotopic_data_csp, monomer_chemical_entities); |
| 1201 |
|
2 |
return *this; |
| 1202 |
|
|
} |
| 1203 |
|
|
|
| 1204 |
|
|
/*! |
| 1205 |
|
|
\brief Increases \a mono_p and \a avg_p by the corresponding member masses |
| 1206 |
|
|
first compounded by \a times. |
| 1207 |
|
|
|
| 1208 |
|
|
Returns true. |
| 1209 |
|
|
*/ |
| 1210 |
|
|
const Monomer & |
| 1211 |
|
6 |
Monomer::accountMasses(double *mono_p, double *avg_p, int times) const |
| 1212 |
|
|
{ |
| 1213 |
1/2
✓ Branch 0 taken 6 times.
✗ Branch 1 not taken.
|
6 |
if(mono_p != nullptr) |
| 1214 |
|
6 |
*mono_p += m_mono * times; |
| 1215 |
|
|
|
| 1216 |
1/2
✓ Branch 0 taken 6 times.
✗ Branch 1 not taken.
|
6 |
if(avg_p != nullptr) |
| 1217 |
|
6 |
*avg_p += m_avg * times; |
| 1218 |
|
|
|
| 1219 |
|
6 |
return *this; |
| 1220 |
|
|
} |
| 1221 |
|
|
|
| 1222 |
|
|
|
| 1223 |
|
|
/*! |
| 1224 |
|
|
\brief Increases \a mono and \a avg by the corresponding member masses first |
| 1225 |
|
|
compounded by \a times. |
| 1226 |
|
|
|
| 1227 |
|
|
Returns true. |
| 1228 |
|
|
*/ |
| 1229 |
|
|
const Monomer & |
| 1230 |
|
18978 |
Monomer::accountMasses(double &mono, double &avg, int times) const |
| 1231 |
|
|
{ |
| 1232 |
|
18978 |
mono += m_mono * times; |
| 1233 |
|
18978 |
avg += m_avg * times; |
| 1234 |
|
|
|
| 1235 |
|
18978 |
return *this; |
| 1236 |
|
|
} |
| 1237 |
|
|
|
| 1238 |
|
|
|
| 1239 |
|
|
/*! |
| 1240 |
|
|
\brief Returns the mass of the type defined by \a mass_type. |
| 1241 |
|
|
*/ |
| 1242 |
|
|
double |
| 1243 |
|
16 |
Monomer::getMass(Enums::MassType mass_type) const |
| 1244 |
|
|
{ |
| 1245 |
2/2
✓ Branch 0 taken 8 times.
✓ Branch 1 taken 8 times.
|
16 |
if(mass_type == Enums::MassType::MONO) |
| 1246 |
|
8 |
return m_mono; |
| 1247 |
1/2
✓ Branch 0 taken 8 times.
✗ Branch 1 not taken.
|
8 |
else if(mass_type == Enums::MassType::AVG) |
| 1248 |
|
8 |
return m_avg; |
| 1249 |
|
|
|
| 1250 |
|
✗ |
qFatalStream() |
| 1251 |
|
✗ |
<< "Mass cannot be anything else than Enums::MassType::MONO or Enums::MassType::AVG."; |
| 1252 |
|
|
|
| 1253 |
|
✗ |
return -1; |
| 1254 |
|
|
} |
| 1255 |
|
|
|
| 1256 |
|
|
|
| 1257 |
|
|
//////////////// FORMULA OPERATIONS ///////////////////// |
| 1258 |
|
|
|
| 1259 |
|
|
/* |
| 1260 |
|
|
\brief Calculates a Formula representing this monomer . |
| 1261 |
|
|
|
| 1262 |
|
|
The calculated formula accounts for this monomer's formula and for its |
| 1263 |
|
|
modifications formulas if any and if \a (monomer_chemical_entities & |
| 1264 |
|
|
MONOMER_CHEMENT_MODIF) is true. |
| 1265 |
|
|
|
| 1266 |
|
|
This monomer's formula must validate using Modif::validate. |
| 1267 |
|
|
|
| 1268 |
|
|
Returns the Formula. |
| 1269 |
|
|
|
| 1270 |
|
|
\sa Modif::accountFormula() |
| 1271 |
|
|
*/ |
| 1272 |
|
|
QString |
| 1273 |
|
287 |
Monomer::calculateFormula(Enums::ChemicalEntity monomer_chemical_entities) const |
| 1274 |
|
|
{ |
| 1275 |
|
|
// We want to return the calculated formula of this monomer that accounts |
| 1276 |
|
|
// for its modifications if so is requested. |
| 1277 |
|
|
|
| 1278 |
|
287 |
IsotopicDataCstSPtr isotopic_data_csp = |
| 1279 |
|
287 |
mcsp_polChemDef->getIsotopicDataCstSPtr(); |
| 1280 |
|
|
|
| 1281 |
|
|
// qDebug() << "Calculating formula for monomer: " << m_name |
| 1282 |
|
|
//<< "with chemical entities:" << monomer_chemical_entities; |
| 1283 |
|
|
|
| 1284 |
1/2
✓ Branch 1 taken 287 times.
✗ Branch 2 not taken.
|
287 |
Formula formula(m_formula); |
| 1285 |
|
|
|
| 1286 |
|
|
// The m_formula above is only a text string. We need to convert that |
| 1287 |
|
|
// into the symbol/count pair by validating it with true true params. |
| 1288 |
|
|
// The formula is asked to validate with storage of the found symbol/count |
| 1289 |
|
|
// pairs and with resetting of the previous contents of the symbol/count |
| 1290 |
|
|
// map. |
| 1291 |
|
|
|
| 1292 |
|
|
// We need to seed the symbol/count pairs because the following call |
| 1293 |
|
|
// (accountFormula()) will update the pairs' values. |
| 1294 |
|
287 |
ErrorList error_list; |
| 1295 |
4/6
✓ Branch 2 taken 287 times.
✗ Branch 3 not taken.
✓ Branch 4 taken 287 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 1 times.
✓ Branch 7 taken 286 times.
|
574 |
if(!formula.validate( |
| 1296 |
|
|
isotopic_data_csp, /*store*/ true, /*reset*/ true, &error_list)) |
| 1297 |
|
|
{ |
| 1298 |
|
1 |
qDebug() << "Formula:" << formula.getActionFormula() |
| 1299 |
|
|
<< "failed to validate with errors:" |
| 1300 |
|
|
<< Utils::joinErrorList(error_list, ", "); |
| 1301 |
|
|
|
| 1302 |
|
1 |
return QString(); |
| 1303 |
|
|
} |
| 1304 |
|
|
|
| 1305 |
|
286 |
bool ok = false; |
| 1306 |
|
|
|
| 1307 |
2/2
✓ Branch 0 taken 138 times.
✓ Branch 1 taken 148 times.
|
286 |
if(static_cast<int>(monomer_chemical_entities) & |
| 1308 |
|
|
static_cast<int>(Enums::ChemicalEntity::MODIF)) |
| 1309 |
|
|
{ |
| 1310 |
2/2
✓ Branch 0 taken 6 times.
✓ Branch 1 taken 138 times.
|
144 |
for(const ModifSPtr &modif_sp : m_modifs) |
| 1311 |
|
|
{ |
| 1312 |
3/8
✓ Branch 1 taken 6 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 6 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 6 times.
✗ Branch 7 not taken.
✗ Branch 8 not taken.
✗ Branch 9 not taken.
|
12 |
formula.accountFormula(modif_sp->formula(/*with_title*/ false), |
| 1313 |
1/2
✓ Branch 1 taken 6 times.
✗ Branch 2 not taken.
|
6 |
mcsp_polChemDef->getIsotopicDataCstSPtr(), |
| 1314 |
|
|
1, |
| 1315 |
|
|
ok); |
| 1316 |
|
|
|
| 1317 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 6 times.
|
6 |
if(!ok) |
| 1318 |
|
✗ |
return QString(); |
| 1319 |
|
|
} |
| 1320 |
|
|
} |
| 1321 |
|
|
|
| 1322 |
1/2
✓ Branch 1 taken 286 times.
✗ Branch 2 not taken.
|
286 |
return formula.getActionFormula(); |
| 1323 |
1/2
✓ Branch 1 taken 287 times.
✗ Branch 2 not taken.
|
574 |
} |
| 1324 |
|
|
|
| 1325 |
|
|
/*! |
| 1326 |
|
|
\brief Parses the monomer XML \a element specifically for \a version. |
| 1327 |
|
|
|
| 1328 |
|
|
Parses the monomer XML element passed as argument and for each |
| 1329 |
|
|
encountered data will set the data to this monomer (this is |
| 1330 |
|
|
called XML rendering).The parsing is delegated to a function that is specific |
| 1331 |
|
|
for for \a version of the polymer chemistry definition. |
| 1332 |
|
|
|
| 1333 |
|
|
The XML element is found in the polymer chemistry definition and has the |
| 1334 |
|
|
following form: |
| 1335 |
|
|
|
| 1336 |
|
|
\code |
| 1337 |
|
|
<monomers> |
| 1338 |
|
|
<mnm> |
| 1339 |
|
|
<name>Glycine</name> |
| 1340 |
|
|
<code>G</code> |
| 1341 |
|
|
<formula>C2H3N1O1</formula> |
| 1342 |
|
|
</mnm> |
| 1343 |
|
|
<mnm> |
| 1344 |
|
|
<name>Alanine</name> |
| 1345 |
|
|
<code>A</code> |
| 1346 |
|
|
<formula>C3H5N1O1</formula> |
| 1347 |
|
|
</mnm> |
| 1348 |
|
|
\endcode |
| 1349 |
|
|
|
| 1350 |
|
|
After setting all the data, this monomer calculates it masses and |
| 1351 |
|
|
validates itself. If any of these steps fails, the error is reported |
| 1352 |
|
|
by returning false. |
| 1353 |
|
|
|
| 1354 |
|
|
\sa validate() |
| 1355 |
|
|
*/ |
| 1356 |
|
|
bool |
| 1357 |
|
1439 |
Monomer::renderXmlMnmElement(const QDomElement &element, |
| 1358 |
|
|
[[maybe_unused]] int version) |
| 1359 |
|
|
{ |
| 1360 |
|
|
|
| 1361 |
|
|
/* In a polymer chemistry definition, the xml node we are in is |
| 1362 |
|
|
* structured this way: |
| 1363 |
|
|
* |
| 1364 |
|
|
* <mnm> |
| 1365 |
|
|
* <name>Glycine</name> |
| 1366 |
|
|
* <code>G</code> |
| 1367 |
|
|
* <formula>C2H3N1O1</formula> |
| 1368 |
|
|
* </mnm> |
| 1369 |
|
|
* |
| 1370 |
|
|
* And the element parameter points to the |
| 1371 |
|
|
* |
| 1372 |
|
|
* <mnm> element tag: |
| 1373 |
|
|
* ^ |
| 1374 |
|
|
* | |
| 1375 |
|
|
* +----- here we are right now. |
| 1376 |
|
|
* |
| 1377 |
|
|
* Which means that element.tagName() == "mnm" and that we'll have |
| 1378 |
|
|
* to go one step down to the first child of the current node in |
| 1379 |
|
|
* order to get to the <name> element. |
| 1380 |
|
|
* |
| 1381 |
|
|
*/ |
| 1382 |
|
|
|
| 1383 |
|
1439 |
m_isValid = true; |
| 1384 |
|
|
|
| 1385 |
|
|
// QString str; |
| 1386 |
|
|
// QTextStream stream(&str); |
| 1387 |
|
|
// QDomNode node = element; |
| 1388 |
|
|
// node.save(stream, 2 /*indent*/); |
| 1389 |
|
|
// qDebug().noquote() << "The element:\n" << str; |
| 1390 |
|
|
|
| 1391 |
2/2
✓ Branch 2 taken 1 times.
✓ Branch 3 taken 1438 times.
|
2878 |
if(element.tagName() != "mnm") |
| 1392 |
|
|
{ |
| 1393 |
1/2
✓ Branch 2 taken 1 times.
✗ Branch 3 not taken.
|
1 |
qCritical() << "The expected <mnm> element is not found."; |
| 1394 |
|
1 |
m_isValid = false; |
| 1395 |
|
1 |
return m_isValid; |
| 1396 |
|
|
} |
| 1397 |
|
|
|
| 1398 |
|
1438 |
QDomElement child; |
| 1399 |
|
|
|
| 1400 |
3/6
✓ Branch 1 taken 1438 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1438 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1438 times.
✗ Branch 8 not taken.
|
2876 |
child = element.firstChildElement("name"); |
| 1401 |
|
|
|
| 1402 |
8/10
✓ Branch 1 taken 1438 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1437 times.
✓ Branch 4 taken 1 times.
✓ Branch 6 taken 1437 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 1436 times.
✓ Branch 9 taken 1 times.
✓ Branch 10 taken 2 times.
✓ Branch 11 taken 1436 times.
|
2875 |
if(child.isNull() || child.text().isEmpty()) |
| 1403 |
|
|
{ |
| 1404 |
1/2
✓ Branch 1 taken 2 times.
✗ Branch 2 not taken.
|
4 |
qCritical() << "The Monomer did not render correctly: problem with the " |
| 1405 |
1/2
✓ Branch 1 taken 2 times.
✗ Branch 2 not taken.
|
2 |
"<name> element."; |
| 1406 |
|
2 |
m_isValid = false; |
| 1407 |
|
2 |
return m_isValid; |
| 1408 |
|
|
} |
| 1409 |
1/2
✓ Branch 1 taken 1436 times.
✗ Branch 2 not taken.
|
1436 |
m_name = child.text(); |
| 1410 |
|
|
// qDebug() << "The name:" << m_name; |
| 1411 |
|
|
|
| 1412 |
3/6
✓ Branch 1 taken 1436 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1436 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1436 times.
✗ Branch 8 not taken.
|
2872 |
child = child.nextSiblingElement("code"); |
| 1413 |
|
|
|
| 1414 |
3/4
✓ Branch 1 taken 1436 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✓ Branch 4 taken 1435 times.
|
1436 |
if(child.isNull()) |
| 1415 |
|
|
{ |
| 1416 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
2 |
qCritical() << "The Monomer did not render correctly: problem with the " |
| 1417 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
"<code> element."; |
| 1418 |
|
1 |
m_isValid = false; |
| 1419 |
|
1 |
return m_isValid; |
| 1420 |
|
|
} |
| 1421 |
1/2
✓ Branch 1 taken 1435 times.
✗ Branch 2 not taken.
|
1435 |
m_code = child.text(); |
| 1422 |
|
|
// qDebug() << "The code:" << m_code; |
| 1423 |
|
|
|
| 1424 |
3/4
✓ Branch 1 taken 1435 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✓ Branch 4 taken 1434 times.
|
1435 |
if(!checkCodeSyntax()) |
| 1425 |
|
|
{ |
| 1426 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
2 |
qCritical() << "The Monomer did not render correctly: problem with the " |
| 1427 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
"code text."; |
| 1428 |
|
1 |
m_isValid = false; |
| 1429 |
|
1 |
return m_isValid; |
| 1430 |
|
|
} |
| 1431 |
|
|
|
| 1432 |
3/6
✓ Branch 1 taken 1434 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1434 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1434 times.
✗ Branch 8 not taken.
|
2868 |
child = child.nextSiblingElement("formula"); |
| 1433 |
|
|
|
| 1434 |
3/4
✓ Branch 1 taken 1434 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✓ Branch 4 taken 1433 times.
|
1434 |
if(child.isNull()) |
| 1435 |
|
|
{ |
| 1436 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
2 |
qCritical() << "The Monomer did not render correctly: problem with the " |
| 1437 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
"<formula> element."; |
| 1438 |
|
1 |
m_isValid = false; |
| 1439 |
|
1 |
return m_isValid; |
| 1440 |
|
|
} |
| 1441 |
|
|
|
| 1442 |
1/2
✓ Branch 1 taken 1433 times.
✗ Branch 2 not taken.
|
1433 |
Formula temp_formula; |
| 1443 |
|
|
|
| 1444 |
3/4
✓ Branch 1 taken 1433 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✓ Branch 4 taken 1432 times.
|
1433 |
if(!temp_formula.renderXmlFormulaElement(child)) |
| 1445 |
|
|
{ |
| 1446 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
2 |
qCritical() |
| 1447 |
|
|
<< "The Monomer did not render correctly: the formula did not " |
| 1448 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
"render correctly."; |
| 1449 |
|
1 |
m_isValid = false; |
| 1450 |
|
1 |
return m_isValid; |
| 1451 |
|
|
} |
| 1452 |
1/2
✓ Branch 1 taken 1432 times.
✗ Branch 2 not taken.
|
1432 |
m_formula = temp_formula.getActionFormula(/*with_title*/ true); |
| 1453 |
|
|
// qDebug() << "The formula:" << m_formula; |
| 1454 |
|
|
|
| 1455 |
|
1432 |
ErrorList error_list; |
| 1456 |
1/2
✓ Branch 1 taken 1432 times.
✗ Branch 2 not taken.
|
1432 |
m_isValid = validate(&error_list); |
| 1457 |
2/2
✓ Branch 0 taken 3 times.
✓ Branch 1 taken 1429 times.
|
1432 |
if(!m_isValid) |
| 1458 |
|
|
{ |
| 1459 |
1/2
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
|
6 |
qCritical() << "The Monomer did not validate successfully after " |
| 1460 |
1/2
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
|
3 |
"rendering, with errors:"; |
| 1461 |
2/4
✓ Branch 1 taken 3 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 3 times.
✗ Branch 5 not taken.
|
6 |
Utils::joinErrorList(error_list, ", "); |
| 1462 |
|
|
} |
| 1463 |
|
|
else |
| 1464 |
|
|
{ |
| 1465 |
|
|
// At this point, because we are creating a Monomer from scratch, |
| 1466 |
|
|
// and not by copying or by assignment, we calculate the masses |
| 1467 |
|
|
// explicitely (validate() does that but not on member m_mono/m_avg |
| 1468 |
|
|
// because the method is const.). |
| 1469 |
|
|
|
| 1470 |
3/6
✓ Branch 1 taken 1429 times.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✓ Branch 4 taken 1429 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 1429 times.
|
1429 |
if(!calculateMasses(nullptr)) |
| 1471 |
|
|
{ |
| 1472 |
|
✗ |
qCritical() << "The Monomer's masses could not be calculated."; |
| 1473 |
|
|
} |
| 1474 |
|
|
} |
| 1475 |
|
|
|
| 1476 |
|
|
// qDebug() << "Correctly rendered Monomer" << m_name << ":" << toString(); |
| 1477 |
|
|
|
| 1478 |
|
1432 |
return m_isValid; |
| 1479 |
|
2871 |
} |
| 1480 |
|
|
|
| 1481 |
|
|
|
| 1482 |
|
|
/*! |
| 1483 |
|
|
\brief Formats this monomer's data as a string suitable to be used as an XML |
| 1484 |
|
|
element in the polymer chemistry definition. |
| 1485 |
|
|
|
| 1486 |
|
|
The typical monomer element that is generated in this function looks like |
| 1487 |
|
|
this: |
| 1488 |
|
|
|
| 1489 |
|
|
\code |
| 1490 |
|
|
<monomers> |
| 1491 |
|
|
<mnm> |
| 1492 |
|
|
<name>Glycine</name> |
| 1493 |
|
|
<code>G</code> |
| 1494 |
|
|
<formula>C2H3N1O1</formula> |
| 1495 |
|
|
</mnm> |
| 1496 |
|
|
\endcode |
| 1497 |
|
|
|
| 1498 |
|
|
The formatting of the XML element takes into account \a offset and \a |
| 1499 |
|
|
indent by prepending the string with \a offset * \a indent character |
| 1500 |
|
|
substring. |
| 1501 |
|
|
|
| 1502 |
|
|
\a indent defaults to two spaces. |
| 1503 |
|
|
|
| 1504 |
|
|
Returns a dynamically allocated string that needs to be freed after |
| 1505 |
|
|
use. |
| 1506 |
|
|
*/ |
| 1507 |
|
|
QString |
| 1508 |
|
21 |
Monomer::formatXmlMnmElement(int offset, const QString &indent) const |
| 1509 |
|
|
{ |
| 1510 |
|
21 |
int newOffset; |
| 1511 |
|
21 |
int iter = 0; |
| 1512 |
|
|
|
| 1513 |
|
21 |
QString lead(""); |
| 1514 |
|
21 |
QString text; |
| 1515 |
|
|
|
| 1516 |
|
|
// Prepare the lead. |
| 1517 |
|
21 |
newOffset = offset; |
| 1518 |
2/2
✓ Branch 0 taken 63 times.
✓ Branch 1 taken 21 times.
|
84 |
while(iter < newOffset) |
| 1519 |
|
|
{ |
| 1520 |
1/2
✓ Branch 1 taken 63 times.
✗ Branch 2 not taken.
|
63 |
lead += indent; |
| 1521 |
|
63 |
++iter; |
| 1522 |
|
|
} |
| 1523 |
|
|
|
| 1524 |
2/4
✓ Branch 1 taken 21 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 21 times.
✗ Branch 5 not taken.
|
42 |
text += QString("%1<mnm>\n").arg(lead); |
| 1525 |
|
|
|
| 1526 |
|
|
// Prepare the lead. |
| 1527 |
|
21 |
++newOffset; |
| 1528 |
|
21 |
lead.clear(); |
| 1529 |
|
21 |
iter = 0; |
| 1530 |
2/2
✓ Branch 1 taken 84 times.
✓ Branch 2 taken 21 times.
|
126 |
while(iter < newOffset) |
| 1531 |
|
|
{ |
| 1532 |
1/2
✓ Branch 1 taken 84 times.
✗ Branch 2 not taken.
|
84 |
lead += indent; |
| 1533 |
|
84 |
++iter; |
| 1534 |
|
|
} |
| 1535 |
|
|
|
| 1536 |
|
|
// Continue with indented elements. |
| 1537 |
|
|
|
| 1538 |
3/6
✓ Branch 1 taken 21 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 21 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 21 times.
✗ Branch 8 not taken.
|
42 |
text += QString("%1<name>%2</name>\n").arg(lead).arg(m_name); |
| 1539 |
|
|
|
| 1540 |
3/6
✓ Branch 1 taken 21 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 21 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 21 times.
✗ Branch 8 not taken.
|
42 |
text += QString("%1<code>%2</code>\n").arg(lead).arg(m_code); |
| 1541 |
|
|
|
| 1542 |
3/6
✓ Branch 1 taken 21 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 21 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 21 times.
✗ Branch 8 not taken.
|
42 |
text += QString("%1<formula>%2</formula>\n").arg(lead).arg(m_formula); |
| 1543 |
|
|
|
| 1544 |
|
|
// Prepare the lead for the closing element. |
| 1545 |
|
21 |
--newOffset; |
| 1546 |
|
21 |
lead.clear(); |
| 1547 |
|
21 |
iter = 0; |
| 1548 |
2/2
✓ Branch 1 taken 63 times.
✓ Branch 2 taken 21 times.
|
105 |
while(iter < newOffset) |
| 1549 |
|
|
{ |
| 1550 |
1/2
✓ Branch 1 taken 63 times.
✗ Branch 2 not taken.
|
63 |
lead += indent; |
| 1551 |
|
63 |
++iter; |
| 1552 |
|
|
} |
| 1553 |
|
|
|
| 1554 |
2/4
✓ Branch 1 taken 21 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 21 times.
✗ Branch 5 not taken.
|
42 |
text += QString("%1</mnm>\n").arg(lead); |
| 1555 |
|
|
|
| 1556 |
|
21 |
return text; |
| 1557 |
|
21 |
} |
| 1558 |
|
|
|
| 1559 |
|
|
|
| 1560 |
|
|
/*! |
| 1561 |
|
|
\brief Parses into this monomer the XML monomer \a element passed as argument. |
| 1562 |
|
|
|
| 1563 |
|
|
The XML element comes from a polymer sequence file, where the monomer is |
| 1564 |
|
|
singled out (not in a sequence string) because it might be modified, like |
| 1565 |
|
|
this: |
| 1566 |
|
|
|
| 1567 |
|
|
\code |
| 1568 |
|
|
<monomer> |
| 1569 |
|
|
<code>S</code> |
| 1570 |
|
|
<mdf> |
| 1571 |
|
|
<name>Phosphorylation</name> |
| 1572 |
|
|
<formula>H1O3P1</formula> |
| 1573 |
|
|
<targets>*</targets> |
| 1574 |
|
|
<maxcount>1</maxcount> |
| 1575 |
|
|
</mdf> |
| 1576 |
|
|
</monomer> |
| 1577 |
|
|
<codes>GRKASGSSPTSPINADKVENEDAFLEEVAEEKPHVKPYFTKTILDMEVVEGSAARFDCKIEGYPDPEVM</codes> |
| 1578 |
|
|
<monomer> |
| 1579 |
|
|
<code>W</code> |
| 1580 |
|
|
<mdf> |
| 1581 |
|
|
<name>Oxidation</name> |
| 1582 |
|
|
<formula>O1</formula> |
| 1583 |
|
|
<targets>*</targets> |
| 1584 |
|
|
<maxcount>1</maxcount> |
| 1585 |
|
|
</mdf> |
| 1586 |
|
|
</monomer> |
| 1587 |
|
|
<codes>YKDDQPVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE</codes> |
| 1588 |
|
|
\endcode |
| 1589 |
|
|
|
| 1590 |
|
|
\a version indicates the format version of this XML \a element. |
| 1591 |
|
|
|
| 1592 |
|
|
As soon as the monomer code is known, while parsing the \a element, the |
| 1593 |
|
|
corresponding monomer is searched in the list of monomers in the member |
| 1594 |
|
|
polymer chemistry definition (\c mcsp_polChemDef). Then, the found monomer is |
| 1595 |
|
|
copied into \c this monomer so that both monomers are identical, effectively |
| 1596 |
|
|
initializing this monomer to the monomer described by the \a element. |
| 1597 |
|
|
|
| 1598 |
|
|
If the \a element contains one or more \c mdf modifications, these |
| 1599 |
|
|
modifications are allocated as \l{Modif}'s and validated. If these |
| 1600 |
|
|
modifications validate successfully, they are appended to this monomer's list |
| 1601 |
|
|
of modifications. |
| 1602 |
|
|
|
| 1603 |
|
|
Returns true if initialization of his monomer with the contents of \a |
| 1604 |
|
|
element succeeded, false otherwise. |
| 1605 |
|
|
|
| 1606 |
|
|
\sa formatXmlMonomerElement(int offset, const QString &indent) |
| 1607 |
|
|
*/ |
| 1608 |
|
|
bool |
| 1609 |
|
52 |
Monomer::renderXmlMonomerElement(const QDomElement &element, |
| 1610 |
|
|
[[maybe_unused]] int version) |
| 1611 |
|
|
{ |
| 1612 |
|
52 |
qDebug(); |
| 1613 |
|
|
|
| 1614 |
|
52 |
m_isValid = true; |
| 1615 |
|
|
|
| 1616 |
|
|
// QString str; |
| 1617 |
|
|
// QTextStream stream(&str); |
| 1618 |
|
|
// QDomNode node = element; |
| 1619 |
|
|
// node.save(stream, 2 /*indent*/); |
| 1620 |
|
|
// qDebug().noquote() << "The element:\n" << str; |
| 1621 |
|
|
|
| 1622 |
1/2
✗ Branch 2 not taken.
✓ Branch 3 taken 52 times.
|
104 |
if(element.tagName() != "monomer") |
| 1623 |
|
|
{ |
| 1624 |
|
✗ |
qCritical() << "The expected <monomer> element is not found."; |
| 1625 |
|
✗ |
m_isValid = false; |
| 1626 |
|
✗ |
return m_isValid; |
| 1627 |
|
|
} |
| 1628 |
|
|
|
| 1629 |
|
52 |
qDebug() << "Indeed a monomer element."; |
| 1630 |
|
|
|
| 1631 |
|
52 |
QDomElement child; |
| 1632 |
|
|
|
| 1633 |
3/6
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 52 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 52 times.
✗ Branch 8 not taken.
|
104 |
child = element.firstChildElement("code"); |
| 1634 |
|
|
|
| 1635 |
5/10
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 52 times.
✗ Branch 4 not taken.
✓ Branch 6 taken 52 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 52 times.
✗ Branch 9 not taken.
✗ Branch 10 not taken.
✓ Branch 11 taken 52 times.
|
104 |
if(child.isNull() || child.text().isEmpty()) |
| 1636 |
|
|
{ |
| 1637 |
|
✗ |
qCritical() << "The Monomer did not render correctly: problem with the " |
| 1638 |
|
✗ |
"<code> element."; |
| 1639 |
|
✗ |
m_isValid = false; |
| 1640 |
|
✗ |
return m_isValid; |
| 1641 |
|
|
} |
| 1642 |
1/2
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
|
52 |
QString code = child.text(); |
| 1643 |
|
|
|
| 1644 |
|
52 |
qDebug() << "The code:" << code; |
| 1645 |
|
|
|
| 1646 |
|
|
// Use the code to access the corresponding Monomer in the list of Monomers |
| 1647 |
|
|
// in the polymer chemistry definition. |
| 1648 |
1/2
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
|
52 |
MonomerSPtr monomer_csp = mcsp_polChemDef->getMonomerCstSPtrByCode(code); |
| 1649 |
|
|
|
| 1650 |
|
52 |
qDebug() << "monomer pointer:" << monomer_csp.get(); |
| 1651 |
|
|
|
| 1652 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 52 times.
|
52 |
if(monomer_csp == nullptr) |
| 1653 |
|
|
{ |
| 1654 |
|
✗ |
qCritical() << "The monomer's code is not found in the polymer chemistry " |
| 1655 |
|
✗ |
"definition."; |
| 1656 |
|
|
|
| 1657 |
|
✗ |
m_isValid = false; |
| 1658 |
|
✗ |
return m_isValid; |
| 1659 |
|
|
} |
| 1660 |
|
|
|
| 1661 |
|
52 |
qDebug() << "monomer name:" << monomer_csp->getName(); |
| 1662 |
|
|
|
| 1663 |
1/2
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
|
52 |
*this = *monomer_csp; |
| 1664 |
|
|
|
| 1665 |
|
|
// Sanity check |
| 1666 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 52 times.
|
52 |
if(m_code != code) |
| 1667 |
|
✗ |
qFatal("Programming error. Both codes should be identical."); |
| 1668 |
|
|
|
| 1669 |
|
|
// And now we have to manage the mdf objects. |
| 1670 |
2/4
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 52 times.
✗ Branch 5 not taken.
|
104 |
child = child.nextSiblingElement(); |
| 1671 |
|
|
|
| 1672 |
3/4
✓ Branch 1 taken 104 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 52 times.
✓ Branch 4 taken 52 times.
|
104 |
while(!child.isNull()) |
| 1673 |
|
|
{ |
| 1674 |
2/4
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✗ Branch 4 not taken.
✓ Branch 5 taken 52 times.
|
104 |
if(child.tagName() != "mdf") |
| 1675 |
|
|
{ |
| 1676 |
|
✗ |
qCritical() |
| 1677 |
|
|
<< "The Monomer did not render correctly: problem with the " |
| 1678 |
|
✗ |
"<mdf> element."; |
| 1679 |
|
|
|
| 1680 |
|
✗ |
m_isValid = false; |
| 1681 |
|
✗ |
return m_isValid; |
| 1682 |
|
|
} |
| 1683 |
|
|
|
| 1684 |
1/4
✓ Branch 2 taken 52 times.
✗ Branch 3 not taken.
✗ Branch 4 not taken.
✗ Branch 5 not taken.
|
52 |
Modif modif(mcsp_polChemDef, child, version); |
| 1685 |
|
|
|
| 1686 |
|
52 |
qDebug() << "20250428-Created Modif:" << modif.getName() |
| 1687 |
|
|
<< "with Formula:" << modif.getFormula(); |
| 1688 |
|
|
|
| 1689 |
4/8
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 52 times.
✗ Branch 5 not taken.
✓ Branch 6 taken 52 times.
✗ Branch 7 not taken.
✗ Branch 8 not taken.
✓ Branch 9 taken 52 times.
|
104 |
if(!modif.calculateMasses(mcsp_polChemDef->getIsotopicDataCstSPtr())) |
| 1690 |
|
|
{ |
| 1691 |
|
✗ |
qCritical() << "Failed to calculate masses for Monomer's Modif" |
| 1692 |
|
✗ |
<< modif.getName(); |
| 1693 |
|
|
|
| 1694 |
|
✗ |
m_isValid = false; |
| 1695 |
|
✗ |
return m_isValid; |
| 1696 |
|
|
} |
| 1697 |
|
|
|
| 1698 |
|
|
// The validation will take care of checking that the <targets> |
| 1699 |
|
|
// element did have correct text inside. |
| 1700 |
|
|
|
| 1701 |
|
52 |
ErrorList error_list; |
| 1702 |
2/4
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✓ Branch 4 taken 52 times.
|
52 |
if(!modif.validate(&error_list)) |
| 1703 |
|
|
{ |
| 1704 |
|
✗ |
qCritical() << "Failed to validate modification" << modif.getName() |
| 1705 |
|
✗ |
<< "with errors:" |
| 1706 |
|
✗ |
<< Utils::joinErrorList(error_list, ", "); |
| 1707 |
|
|
|
| 1708 |
|
✗ |
m_isValid = false; |
| 1709 |
|
✗ |
return m_isValid; |
| 1710 |
|
|
} |
| 1711 |
|
|
|
| 1712 |
|
52 |
error_list.clear(); |
| 1713 |
|
|
|
| 1714 |
|
|
// qDebug() << "At this point, going to modify the monomer."; |
| 1715 |
1/2
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
|
52 |
QString uuid = modify(modif, /*override*/ false, &error_list); |
| 1716 |
|
|
|
| 1717 |
|
|
// qDebug() << "The returned uuid:" << uuid; |
| 1718 |
|
|
|
| 1719 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 52 times.
|
52 |
if(uuid.isEmpty()) |
| 1720 |
|
|
{ |
| 1721 |
|
✗ |
qCritical() << "The monomer could not be modified, with errors:" |
| 1722 |
|
✗ |
<< Utils::joinErrorList(error_list, ", "); |
| 1723 |
|
|
|
| 1724 |
|
✗ |
m_isValid = false; |
| 1725 |
|
✗ |
return m_isValid; |
| 1726 |
|
|
} |
| 1727 |
|
|
|
| 1728 |
2/4
✓ Branch 1 taken 52 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 52 times.
✗ Branch 5 not taken.
|
104 |
child = child.nextSiblingElement(); |
| 1729 |
|
52 |
} |
| 1730 |
|
|
|
| 1731 |
|
52 |
m_isValid = true; |
| 1732 |
|
52 |
return m_isValid; |
| 1733 |
|
104 |
} |
| 1734 |
|
|
|
| 1735 |
|
|
|
| 1736 |
|
|
/*! |
| 1737 |
|
|
\brief Formats a string suitable to be used as an XML element in a |
| 1738 |
|
|
polymer sequence file. |
| 1739 |
|
|
|
| 1740 |
|
|
The typical monomer element that is generated in this function looks like |
| 1741 |
|
|
this: |
| 1742 |
|
|
|
| 1743 |
|
|
\code |
| 1744 |
|
|
<monomer> |
| 1745 |
|
|
<code>S</code> |
| 1746 |
|
|
<prop> |
| 1747 |
|
|
<name>MODIF</name> |
| 1748 |
|
|
<data>Phosphorylation</data> |
| 1749 |
|
|
</prop> |
| 1750 |
|
|
<prop> |
| 1751 |
|
|
<name>COMMENT</name> |
| 1752 |
|
|
<data>Phosphorylation is only partial</data> |
| 1753 |
|
|
</prop> |
| 1754 |
|
|
</monomer> |
| 1755 |
|
|
\endcode |
| 1756 |
|
|
|
| 1757 |
|
|
The formatting of the XML element takes into account \a offset and \a |
| 1758 |
|
|
indent by prepending the string with \a offset * \a indent character |
| 1759 |
|
|
substring. |
| 1760 |
|
|
|
| 1761 |
|
|
\a indent defaults to two spaces. |
| 1762 |
|
|
|
| 1763 |
|
|
Returns a string. |
| 1764 |
|
|
*/ |
| 1765 |
|
|
QString |
| 1766 |
|
1 |
Monomer::formatXmlMonomerElement(int offset, const QString &indent) const |
| 1767 |
|
|
{ |
| 1768 |
|
1 |
int newOffset; |
| 1769 |
|
1 |
int iter = 0; |
| 1770 |
|
|
|
| 1771 |
|
1 |
QString lead(""); |
| 1772 |
|
1 |
QString text; |
| 1773 |
|
|
|
| 1774 |
|
|
// Prepare the lead. |
| 1775 |
|
1 |
newOffset = offset; |
| 1776 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 1 times.
|
1 |
while(iter < newOffset) |
| 1777 |
|
|
{ |
| 1778 |
|
✗ |
lead += indent; |
| 1779 |
|
✗ |
++iter; |
| 1780 |
|
|
} |
| 1781 |
|
|
|
| 1782 |
3/6
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
|
2 |
text.append(QString("%1<monomer>\n").arg(lead)); |
| 1783 |
|
|
|
| 1784 |
|
|
// Prepare the lead for the <code> child that is indented. |
| 1785 |
|
1 |
++newOffset; |
| 1786 |
|
1 |
lead.clear(); |
| 1787 |
|
1 |
iter = 0; |
| 1788 |
2/2
✓ Branch 1 taken 1 times.
✓ Branch 2 taken 1 times.
|
3 |
while(iter < newOffset) |
| 1789 |
|
|
{ |
| 1790 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
lead += indent; |
| 1791 |
|
1 |
++iter; |
| 1792 |
|
|
} |
| 1793 |
|
|
|
| 1794 |
|
1 |
QString code_element_string = |
| 1795 |
3/6
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
|
1 |
QString("%1<code>%2</code>\n").arg(lead).arg(m_code); |
| 1796 |
|
1 |
qDebug() << "code element:" << code_element_string; |
| 1797 |
|
|
|
| 1798 |
1/2
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
|
1 |
text.append(code_element_string); |
| 1799 |
|
|
|
| 1800 |
|
|
// The monomer may have any number of modif objects, which we have |
| 1801 |
|
|
// to document here. |
| 1802 |
|
|
|
| 1803 |
|
|
// Continue with indented <mdf> element(s) (same indent as for <code>). |
| 1804 |
|
|
|
| 1805 |
2/2
✓ Branch 0 taken 1 times.
✓ Branch 1 taken 1 times.
|
2 |
for(const ModifSPtr &modif_sp : m_modifs) |
| 1806 |
2/4
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
|
2 |
text.append(modif_sp->formatXmlMdfElement(newOffset, indent)); |
| 1807 |
|
|
|
| 1808 |
|
|
// Prepare the lead for the closing element. |
| 1809 |
|
1 |
--newOffset; |
| 1810 |
|
1 |
lead.clear(); |
| 1811 |
|
1 |
iter = 0; |
| 1812 |
1/2
✗ Branch 1 not taken.
✓ Branch 2 taken 1 times.
|
2 |
while(iter < newOffset) |
| 1813 |
|
|
{ |
| 1814 |
|
✗ |
lead += indent; |
| 1815 |
|
✗ |
++iter; |
| 1816 |
|
|
} |
| 1817 |
|
|
|
| 1818 |
3/6
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 1 times.
✗ Branch 5 not taken.
✓ Branch 7 taken 1 times.
✗ Branch 8 not taken.
|
2 |
text.append(QString("%1</monomer>\n").arg(lead)); |
| 1819 |
|
|
|
| 1820 |
|
|
// QString debug_message = |
| 1821 |
|
|
// QString("%1\n%2\n").arg("Returning string:").arg(text); |
| 1822 |
|
|
// qDebug().noquote() << debug_message; |
| 1823 |
|
|
|
| 1824 |
|
1 |
return text; |
| 1825 |
|
1 |
} |
| 1826 |
|
|
|
| 1827 |
|
|
|
| 1828 |
|
|
//////////////// UTILS ///////////////////// |
| 1829 |
|
|
|
| 1830 |
|
|
/*! |
| 1831 |
|
|
\brief Stores the Modif instance \a modif_sp pointer in the member container. |
| 1832 |
|
|
|
| 1833 |
|
|
The \a modif_sp is stored as is, without duplication. |
| 1834 |
|
|
|
| 1835 |
|
|
Returns the Uuid string associated to the stored Modif. |
| 1836 |
|
|
*/ |
| 1837 |
|
|
QString |
| 1838 |
|
137 |
Monomer::storeModif(const ModifSPtr &modif_sp) |
| 1839 |
|
|
{ |
| 1840 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 137 times.
|
137 |
if(modif_sp == nullptr) |
| 1841 |
|
✗ |
qFatalStream() << "The provided ModifSPtr is nullptr."; |
| 1842 |
|
|
|
| 1843 |
|
137 |
qDebug() << "Right before storage, there are currently" << m_modifs.size() |
| 1844 |
|
|
<< "modifications."; |
| 1845 |
|
|
|
| 1846 |
|
|
// Do not store an item twice. |
| 1847 |
3/6
✓ Branch 1 taken 137 times.
✗ Branch 2 not taken.
✓ Branch 4 taken 137 times.
✗ Branch 5 not taken.
✗ Branch 6 not taken.
✓ Branch 7 taken 137 times.
|
274 |
if(hasModif(modif_sp) || !getUuidForModif(modif_sp).isEmpty()) |
| 1848 |
|
✗ |
qFatalStream() << "It is prohibited to store the same ModifSPtr more than once."; |
| 1849 |
|
|
|
| 1850 |
|
137 |
qDebug() << "Ok, we can go on."; |
| 1851 |
|
|
|
| 1852 |
|
|
// Even if we get a ref to shared_ptr, the reference count increment will |
| 1853 |
|
|
// occur. |
| 1854 |
|
137 |
m_modifs.push_back(modif_sp); |
| 1855 |
|
137 |
QString uuid = QUuid::createUuid().toString(); |
| 1856 |
1/2
✓ Branch 2 taken 137 times.
✗ Branch 3 not taken.
|
137 |
m_uuidModifPairs.push_back(UuidModifWPtrPair(uuid, modif_sp)); |
| 1857 |
|
|
|
| 1858 |
|
137 |
qDebug() << "Right after storage, there are currently" << m_modifs.size() |
| 1859 |
|
|
<< "modifications."; |
| 1860 |
|
|
|
| 1861 |
|
137 |
return uuid; |
| 1862 |
|
✗ |
} |
| 1863 |
|
|
|
| 1864 |
|
|
/*! |
| 1865 |
|
|
\brief Stores the Modif instance \a modif in the member container. |
| 1866 |
|
|
|
| 1867 |
|
|
The \a modif is used to craft a ModifSPtr that is stored. |
| 1868 |
|
|
|
| 1869 |
|
|
Returns the Uuid string associated to the stored Modif. |
| 1870 |
|
|
*/ |
| 1871 |
|
|
QString |
| 1872 |
|
✗ |
Monomer::storeModif(const Modif &modif) |
| 1873 |
|
|
{ |
| 1874 |
|
✗ |
ModifSPtr modif_sp = std::make_shared<Modif>(modif); |
| 1875 |
|
|
|
| 1876 |
|
✗ |
if(modif_sp == nullptr) |
| 1877 |
|
|
{ |
| 1878 |
|
✗ |
qFatalStream() << "Failed to allocate ModifSPtr."; |
| 1879 |
|
✗ |
return ""; |
| 1880 |
|
|
} |
| 1881 |
|
|
|
| 1882 |
|
✗ |
return storeModif(modif_sp); |
| 1883 |
|
✗ |
} |
| 1884 |
|
|
|
| 1885 |
|
|
|
| 1886 |
|
|
/*! |
| 1887 |
|
|
\brief Returns true if \a modif_sp was found in the member container of Modif |
| 1888 |
|
|
instances, false otherwise. |
| 1889 |
|
|
*/ |
| 1890 |
|
|
bool |
| 1891 |
|
310 |
Monomer::hasModif(const ModifSPtr &modif_sp) const |
| 1892 |
|
|
{ |
| 1893 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 310 times.
|
310 |
if(modif_sp == nullptr) |
| 1894 |
|
✗ |
qFatalStream() << "Pointer cannot be nullptr."; |
| 1895 |
|
|
|
| 1896 |
|
310 |
std::vector<ModifSPtr>::const_iterator the_iterator_cst = |
| 1897 |
|
620 |
std::find_if(m_modifs.cbegin(), |
| 1898 |
|
|
m_modifs.cend(), |
| 1899 |
5/10
✓ Branch 1 taken 310 times.
✗ Branch 2 not taken.
✓ Branch 5 taken 310 times.
✗ Branch 6 not taken.
✓ Branch 9 taken 310 times.
✗ Branch 10 not taken.
✓ Branch 11 taken 310 times.
✗ Branch 12 not taken.
✓ Branch 14 taken 310 times.
✗ Branch 15 not taken.
|
1860 |
[modif_sp](const ModifSPtr &the_modif_sp) { |
| 1900 |
11/14
✓ Branch 0 taken 8 times.
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✗ Branch 4 not taken.
✓ Branch 5 taken 1 times.
✓ Branch 6 taken 1 times.
✗ Branch 7 not taken.
✓ Branch 8 taken 6 times.
✓ Branch 9 taken 11 times.
✓ Branch 10 taken 4 times.
✓ Branch 11 taken 26 times.
✓ Branch 12 taken 17 times.
✓ Branch 13 taken 42 times.
|
115 |
return the_modif_sp == modif_sp; |
| 1901 |
|
|
}); |
| 1902 |
|
|
|
| 1903 |
2/2
✓ Branch 0 taken 274 times.
✓ Branch 1 taken 36 times.
|
310 |
if(the_iterator_cst == m_modifs.cend()) |
| 1904 |
|
|
{ |
| 1905 |
|
274 |
std::vector<UuidModifWPtrPair>::const_iterator the_pair_iterator_cst = |
| 1906 |
|
548 |
std::find_if(m_uuidModifPairs.cbegin(), |
| 1907 |
|
|
m_uuidModifPairs.cend(), |
| 1908 |
5/10
✓ Branch 2 taken 274 times.
✗ Branch 3 not taken.
✓ Branch 6 taken 274 times.
✗ Branch 7 not taken.
✓ Branch 10 taken 274 times.
✗ Branch 11 not taken.
✓ Branch 12 taken 274 times.
✗ Branch 13 not taken.
✓ Branch 15 taken 274 times.
✗ Branch 16 not taken.
|
1644 |
[modif_sp](const UuidModifWPtrPair &the_pair) { |
| 1909 |
2/2
✓ Branch 1 taken 76 times.
✓ Branch 2 taken 2 times.
|
78 |
return the_pair.second.lock() == modif_sp; |
| 1910 |
|
|
}); |
| 1911 |
|
|
|
| 1912 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 274 times.
|
274 |
if(the_pair_iterator_cst != m_uuidModifPairs.cend()) |
| 1913 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 1914 |
|
|
|
| 1915 |
|
274 |
return false; |
| 1916 |
|
|
} |
| 1917 |
|
|
|
| 1918 |
|
|
return true; |
| 1919 |
|
|
} |
| 1920 |
|
|
|
| 1921 |
|
|
/*! |
| 1922 |
|
|
\brief Returns true if \a modif_sp was found in the member container of |
| 1923 |
|
|
Uuid-Modif pairs, false otherwise. |
| 1924 |
|
|
*/ |
| 1925 |
|
|
bool |
| 1926 |
|
✗ |
Monomer::hasUuid(const ModifSPtr &modif_sp) const |
| 1927 |
|
|
{ |
| 1928 |
|
✗ |
if(modif_sp == nullptr) |
| 1929 |
|
✗ |
qFatalStream() << "Pointer cannot be nullptr."; |
| 1930 |
|
|
|
| 1931 |
|
✗ |
std::vector<UuidModifWPtrPair>::const_iterator the_iterator_cst = |
| 1932 |
|
✗ |
std::find_if(m_uuidModifPairs.cbegin(), |
| 1933 |
|
|
m_uuidModifPairs.cend(), |
| 1934 |
|
✗ |
[modif_sp](const UuidModifWPtrPair &the_pair) { |
| 1935 |
|
✗ |
return the_pair.second.lock() == modif_sp; |
| 1936 |
|
|
}); |
| 1937 |
|
|
|
| 1938 |
|
✗ |
if(the_iterator_cst == m_uuidModifPairs.cend()) |
| 1939 |
|
|
return false; |
| 1940 |
|
|
|
| 1941 |
|
|
// Sanity check |
| 1942 |
|
|
|
| 1943 |
|
✗ |
if(!hasModif(modif_sp)) |
| 1944 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 1945 |
|
|
|
| 1946 |
|
|
return true; |
| 1947 |
|
|
} |
| 1948 |
|
|
|
| 1949 |
|
|
/*! |
| 1950 |
|
|
\brief Returns the Monomer instance pointer in the member container that is |
| 1951 |
|
|
associated to the \a uuid Uuid string. |
| 1952 |
|
|
|
| 1953 |
|
|
If no such Monomer instance pointer is found, nullptr is returned. |
| 1954 |
|
|
*/ |
| 1955 |
|
|
ModifSPtr |
| 1956 |
|
11 |
Monomer::getModifForUuid(const QString &uuid) const |
| 1957 |
|
|
{ |
| 1958 |
|
11 |
qDebug() << "There are currently" << m_modifs.size() |
| 1959 |
|
|
<< "modifications. The Modif uuid that is asked for:" << uuid; |
| 1960 |
|
|
|
| 1961 |
2/2
✓ Branch 0 taken 10 times.
✓ Branch 1 taken 1 times.
|
11 |
std::vector<std::pair<QString, ModifWPtr>>::const_iterator the_iterator_cst = |
| 1962 |
|
22 |
std::find_if(m_uuidModifPairs.cbegin(), |
| 1963 |
|
|
m_uuidModifPairs.cend(), |
| 1964 |
8/8
✓ Branch 0 taken 10 times.
✓ Branch 1 taken 1 times.
✓ Branch 3 taken 10 times.
✓ Branch 4 taken 1 times.
✓ Branch 5 taken 10 times.
✓ Branch 6 taken 1 times.
✓ Branch 8 taken 10 times.
✓ Branch 9 taken 1 times.
|
95 |
[uuid](const UuidModifWPtrPair &the_pair) { |
| 1965 |
|
19 |
qDebug() << "Iterating into" << the_pair.first |
| 1966 |
|
|
<< "while searching for" << uuid; |
| 1967 |
8/14
✗ Branch 0 not taken.
✓ Branch 1 taken 1 times.
✗ Branch 2 not taken.
✓ Branch 3 taken 1 times.
✗ Branch 4 not taken.
✓ Branch 5 taken 1 times.
✓ Branch 6 taken 1 times.
✗ Branch 7 not taken.
✗ Branch 8 not taken.
✓ Branch 9 taken 2 times.
✗ Branch 10 not taken.
✓ Branch 11 taken 3 times.
✓ Branch 12 taken 9 times.
✓ Branch 13 taken 1 times.
|
16 |
return the_pair.first == uuid; |
| 1968 |
|
|
}); |
| 1969 |
|
|
|
| 1970 |
2/2
✓ Branch 0 taken 1 times.
✓ Branch 1 taken 10 times.
|
11 |
if(the_iterator_cst == m_uuidModifPairs.cend()) |
| 1971 |
|
1 |
return nullptr; |
| 1972 |
|
|
|
| 1973 |
|
10 |
ModifSPtr modif_sp = (*the_iterator_cst).second.lock(); |
| 1974 |
|
|
|
| 1975 |
|
|
// Sanity check |
| 1976 |
|
|
|
| 1977 |
2/4
✓ Branch 1 taken 10 times.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✓ Branch 4 taken 10 times.
|
10 |
if(!hasModif(modif_sp)) |
| 1978 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 1979 |
|
|
|
| 1980 |
|
10 |
return modif_sp; |
| 1981 |
|
10 |
} |
| 1982 |
|
|
|
| 1983 |
|
|
/*! |
| 1984 |
|
|
\brief Returns the UUID string identifying \a modif_sp in the member container. |
| 1985 |
|
|
|
| 1986 |
|
|
If no such Modif is found, an empty string is returned. |
| 1987 |
|
|
*/ |
| 1988 |
|
|
QString |
| 1989 |
|
150 |
Monomer::getUuidForModif(const ModifSPtr &modif_sp) const |
| 1990 |
|
|
{ |
| 1991 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 150 times.
|
150 |
if(modif_sp == nullptr) |
| 1992 |
|
✗ |
qFatalStream() << "Pointer cannot be nullptr."; |
| 1993 |
|
|
|
| 1994 |
|
150 |
std::vector<UuidModifWPtrPair>::const_iterator the_iterator_cst = |
| 1995 |
|
300 |
std::find_if(m_uuidModifPairs.cbegin(), |
| 1996 |
|
|
m_uuidModifPairs.cend(), |
| 1997 |
5/10
✓ Branch 2 taken 150 times.
✗ Branch 3 not taken.
✓ Branch 6 taken 150 times.
✗ Branch 7 not taken.
✓ Branch 10 taken 150 times.
✗ Branch 11 not taken.
✓ Branch 12 taken 150 times.
✗ Branch 13 not taken.
✓ Branch 15 taken 150 times.
✗ Branch 16 not taken.
|
900 |
[modif_sp](const UuidModifWPtrPair &the_pair) { |
| 1998 |
|
|
// Do not query the modif_sp managed object because it can |
| 1999 |
|
|
// be nullptr! |
| 2000 |
2/2
✓ Branch 1 taken 51 times.
✓ Branch 2 taken 1 times.
|
52 |
return the_pair.second.lock() == modif_sp; |
| 2001 |
|
|
}); |
| 2002 |
|
|
|
| 2003 |
2/2
✓ Branch 0 taken 137 times.
✓ Branch 1 taken 13 times.
|
150 |
if(the_iterator_cst == m_uuidModifPairs.cend()) |
| 2004 |
|
|
{ |
| 2005 |
|
|
// Sanity check |
| 2006 |
1/2
✗ Branch 1 not taken.
✓ Branch 2 taken 137 times.
|
137 |
if(hasModif(modif_sp)) |
| 2007 |
|
✗ |
qFatalStream() << "Inconsistency between the m_modifs and the " |
| 2008 |
|
✗ |
"m_uuidModifPairs vectors."; |
| 2009 |
|
|
|
| 2010 |
|
137 |
return QString(); |
| 2011 |
|
|
} |
| 2012 |
|
|
|
| 2013 |
|
|
// Sanity check |
| 2014 |
1/2
✗ Branch 1 not taken.
✓ Branch 2 taken 13 times.
|
13 |
if(!hasModif(modif_sp)) |
| 2015 |
|
✗ |
qFatalStream() |
| 2016 |
|
✗ |
<< "Inconsistency between the m_modifs and the m_uuidModifPairs vectors."; |
| 2017 |
|
|
|
| 2018 |
1/2
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
|
163 |
return (*the_iterator_cst).first; |
| 2019 |
|
|
} |
| 2020 |
|
|
|
| 2021 |
|
|
|
| 2022 |
|
|
/*! |
| 2023 |
|
|
\brief Returns a container of QString instances that correspond to the UUID |
| 2024 |
|
|
strings that identify all the Modif instances involved in this Monomer. |
| 2025 |
|
|
|
| 2026 |
|
|
If no Modif is found, an empty container is returned. |
| 2027 |
|
|
*/ |
| 2028 |
|
|
std::vector<QString> |
| 2029 |
|
✗ |
Monomer::getAllModifUuids() const |
| 2030 |
|
|
{ |
| 2031 |
|
✗ |
std::vector<QString> the_uuid_strings; |
| 2032 |
|
|
|
| 2033 |
|
✗ |
for(const UuidModifCstWPtrPair pair : m_uuidModifPairs) |
| 2034 |
|
✗ |
the_uuid_strings.push_back(pair.first); |
| 2035 |
|
|
|
| 2036 |
|
|
// Sanity check |
| 2037 |
|
✗ |
if(the_uuid_strings.size() != m_modifs.size()) |
| 2038 |
|
✗ |
qFatalStream() << "Inconsistency between the <object>_s and <uuid-object> pairs."; |
| 2039 |
|
|
|
| 2040 |
|
✗ |
return the_uuid_strings; |
| 2041 |
|
✗ |
} |
| 2042 |
|
|
|
| 2043 |
|
|
void |
| 2044 |
|
✗ |
Monomer::cleanupModifs() |
| 2045 |
|
|
{ |
| 2046 |
|
✗ |
qDebug() << "At beginning, count of UUID-Modif pairs:" |
| 2047 |
|
|
<< m_uuidModifPairs.size(); |
| 2048 |
|
|
|
| 2049 |
|
✗ |
std::vector<UuidModifWPtrPair>::iterator the_iterator = |
| 2050 |
|
✗ |
m_uuidModifPairs.begin(); |
| 2051 |
|
✗ |
std::vector<UuidModifWPtrPair>::iterator the_end_iterator = |
| 2052 |
|
✗ |
m_uuidModifPairs.end(); |
| 2053 |
|
|
|
| 2054 |
|
✗ |
while(the_iterator != the_end_iterator) |
| 2055 |
|
|
{ |
| 2056 |
|
✗ |
if((*the_iterator).second.expired() || |
| 2057 |
|
✗ |
(*the_iterator).second.lock() == nullptr || |
| 2058 |
|
✗ |
!hasModif((*the_iterator).second.lock())) |
| 2059 |
|
✗ |
the_iterator = m_uuidModifPairs.erase(the_iterator); |
| 2060 |
|
|
else |
| 2061 |
|
✗ |
++the_iterator; |
| 2062 |
|
|
} |
| 2063 |
|
|
|
| 2064 |
|
✗ |
qDebug() << "At end, count of UUID-Modif pairs:" << m_uuidModifPairs.size(); |
| 2065 |
|
✗ |
} |
| 2066 |
|
|
|
| 2067 |
|
|
|
| 2068 |
|
|
bool |
| 2069 |
|
13 |
Monomer::removeModif(ModifSPtr modif_sp) |
| 2070 |
|
|
{ |
| 2071 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 13 times.
|
13 |
if(modif_sp == nullptr || modif_sp.get() == nullptr) |
| 2072 |
|
✗ |
qFatalStream() << "Cannot be that pointer is nullptr."; |
| 2073 |
|
|
|
| 2074 |
|
|
// We will need this anyway. |
| 2075 |
|
13 |
QString uuid = getUuidForModif(modif_sp); |
| 2076 |
|
|
|
| 2077 |
|
|
// Some controls are in order: we have to check that at index, there is |
| 2078 |
|
|
// a ModifSPtr that is present both in m_modifs and in |
| 2079 |
|
|
// m_uuidModifPairs. |
| 2080 |
|
|
|
| 2081 |
1/2
✓ Branch 1 taken 13 times.
✗ Branch 2 not taken.
|
26 |
std::vector<ModifSPtr>::const_iterator the_iterator_cst = std::find_if( |
| 2082 |
2/4
✓ Branch 2 taken 13 times.
✗ Branch 3 not taken.
✓ Branch 6 taken 13 times.
✗ Branch 7 not taken.
|
39 |
m_modifs.begin(), m_modifs.end(), [modif_sp](ModifSPtr iter_modif_sp) { |
| 2083 |
1/2
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
|
13 |
return iter_modif_sp == modif_sp; |
| 2084 |
1/2
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
|
13 |
}); |
| 2085 |
|
|
|
| 2086 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 13 times.
|
13 |
if(the_iterator_cst == m_modifs.end()) |
| 2087 |
|
|
{ |
| 2088 |
|
✗ |
qCritical() << "The ModifSPtr was not found in the container."; |
| 2089 |
|
|
|
| 2090 |
|
✗ |
if(!uuid.isEmpty()) |
| 2091 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 2092 |
|
|
|
| 2093 |
|
✗ |
return false; |
| 2094 |
|
|
} |
| 2095 |
|
|
|
| 2096 |
|
|
// At this point, both containers contain modif_sp. |
| 2097 |
|
|
|
| 2098 |
|
13 |
m_modifs.erase(the_iterator_cst); |
| 2099 |
|
|
|
| 2100 |
1/2
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
|
13 |
std::vector<UuidModifWPtrPair>::const_iterator the_pair_iterator_cst = |
| 2101 |
|
26 |
std::find_if(m_uuidModifPairs.cbegin(), |
| 2102 |
|
|
m_uuidModifPairs.cend(), |
| 2103 |
2/4
✓ Branch 0 taken 13 times.
✗ Branch 1 not taken.
✓ Branch 3 taken 13 times.
✗ Branch 4 not taken.
|
65 |
[uuid](const UuidModifWPtrPair &the_pair) { |
| 2104 |
|
|
// Do not query the modif_sp managed object because it can |
| 2105 |
|
|
// be nullptr! |
| 2106 |
4/14
✓ Branch 0 taken 4 times.
✗ Branch 1 not taken.
✗ Branch 2 not taken.
✗ Branch 3 not taken.
✗ Branch 4 not taken.
✗ Branch 5 not taken.
✗ Branch 6 not taken.
✗ Branch 7 not taken.
✓ Branch 8 taken 3 times.
✗ Branch 9 not taken.
✓ Branch 10 taken 2 times.
✗ Branch 11 not taken.
✓ Branch 12 taken 4 times.
✗ Branch 13 not taken.
|
13 |
return the_pair.first == uuid; |
| 2107 |
|
|
}); |
| 2108 |
|
|
|
| 2109 |
1/2
✗ Branch 0 not taken.
✓ Branch 1 taken 13 times.
|
13 |
if(the_pair_iterator_cst == m_uuidModifPairs.cend()) |
| 2110 |
|
✗ |
qFatalStream() << "Inconsistency between m_modifs and m_uuidModifPairs."; |
| 2111 |
|
|
|
| 2112 |
|
13 |
m_uuidModifPairs.erase(the_pair_iterator_cst); |
| 2113 |
|
|
|
| 2114 |
|
13 |
return true; |
| 2115 |
|
13 |
} |
| 2116 |
|
|
|
| 2117 |
|
|
/*! |
| 2118 |
|
|
\brief Clears all the data of the Monomer instance. |
| 2119 |
|
|
*/ |
| 2120 |
|
|
void |
| 2121 |
|
✗ |
Monomer::clear() |
| 2122 |
|
|
{ |
| 2123 |
|
✗ |
mcsp_polChemDef = nullptr; |
| 2124 |
|
✗ |
m_name = ""; |
| 2125 |
|
✗ |
m_code = ""; |
| 2126 |
|
✗ |
m_formula = ""; |
| 2127 |
|
|
|
| 2128 |
|
✗ |
m_mono = 0.0; |
| 2129 |
|
✗ |
m_avg = 0.0; |
| 2130 |
|
|
|
| 2131 |
|
✗ |
m_modifs.clear(); |
| 2132 |
|
|
|
| 2133 |
|
✗ |
m_isValid = false; |
| 2134 |
|
✗ |
} |
| 2135 |
|
|
|
| 2136 |
|
|
/*! |
| 2137 |
|
|
\brief Returns a text string representing this Monomer instance. |
| 2138 |
|
|
*/ |
| 2139 |
|
|
QString |
| 2140 |
|
✗ |
Monomer::toString() const |
| 2141 |
|
|
{ |
| 2142 |
|
✗ |
return QString( |
| 2143 |
|
✗ |
"Monomer: %1 - %2 - %3 - %4 - %5 - modifs: %6 - is valid: %7\n") |
| 2144 |
|
✗ |
.arg(m_name) |
| 2145 |
|
✗ |
.arg(m_code) |
| 2146 |
|
✗ |
.arg(m_formula) |
| 2147 |
|
✗ |
.arg(m_mono, 0, 'f', ATOM_DEC_PLACES) |
| 2148 |
|
✗ |
.arg(m_avg, 0, 'f', ATOM_DEC_PLACES) |
| 2149 |
|
✗ |
.arg(m_modifs.size()) |
| 2150 |
|
✗ |
.arg(m_isValid); |
| 2151 |
|
|
} |
| 2152 |
|
|
|
| 2153 |
|
|
|
| 2154 |
|
|
} // namespace libXpertMassCore |
| 2155 |
|
|
} // namespace MsXpS |
| 2156 |
|
|
|